NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, May 21, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS38038.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38038.1 Public Mus musculus 2 Meig1 23 108 98 CCDS HistoryNCBI Gene:104362Re-query CCDS DB by CCDS ID:38038.1Re-query CCDS DB by GeneID:104362See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38038.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000064685.13 ENSMUSP00000070310.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064685.13Link to Ensembl Protein Viewer:ENSMUSP00000070310.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000064685Re-query CCDS DB by Protein ID:ENSMUSP00000070310
Original member Current member EBI ENSMUST00000115081.7 ENSMUSP00000110733.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115081.7Link to Ensembl Protein Viewer:ENSMUSP00000110733.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000115081Re-query CCDS DB by Protein ID:ENSMUSP00000110733
Original member Current member EBI ENSMUST00000115082.9 ENSMUSP00000110734.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115082.9Link to Ensembl Protein Viewer:ENSMUSP00000110734.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000115082Re-query CCDS DB by Protein ID:ENSMUSP00000110734
Original member Current member EBI ENSMUST00000115083.7 ENSMUSP00000110735.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115083.7Link to Ensembl Protein Viewer:ENSMUSP00000110735.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000115083Re-query CCDS DB by Protein ID:ENSMUSP00000110735
Original member Current member EBI ENSMUST00000115084.7 ENSMUSP00000110736.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115084.7Link to Ensembl Protein Viewer:ENSMUSP00000110736.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000115084Re-query CCDS DB by Protein ID:ENSMUSP00000110736
Original member Current member NCBI NM_001355205.1 NP_001342134.1 Accepted alive Link to Nucleotide Sequence:NM_001355205.1Link to Protein Sequence:NP_001342134.1Re-query CCDS DB by Nucleotide ID:NM_001355205Re-query CCDS DB by Protein ID:NP_001342134Link to BLAST:NP_001342134.1
Original member Current member NCBI NM_001355207.1 NP_001342136.1 Accepted alive Link to Nucleotide Sequence:NM_001355207.1Link to Protein Sequence:NP_001342136.1Re-query CCDS DB by Nucleotide ID:NM_001355207Re-query CCDS DB by Protein ID:NP_001342136Link to BLAST:NP_001342136.1
Original member Current member NCBI NM_001355208.1 NP_001342137.1 Accepted alive Link to Nucleotide Sequence:NM_001355208.1Link to Protein Sequence:NP_001342137.1Re-query CCDS DB by Nucleotide ID:NM_001355208Re-query CCDS DB by Protein ID:NP_001342137Link to BLAST:NP_001342137.1
Original member Current member NCBI NM_001355209.1 NP_001342138.1 Accepted alive Link to Nucleotide Sequence:NM_001355209.1Link to Protein Sequence:NP_001342138.1Re-query CCDS DB by Nucleotide ID:NM_001355209Re-query CCDS DB by Protein ID:NP_001342138Link to BLAST:NP_001342138.1
Original member Current member NCBI NM_001355210.1 NP_001342139.1 Accepted alive Link to Nucleotide Sequence:NM_001355210.1Link to Protein Sequence:NP_001342139.1Re-query CCDS DB by Nucleotide ID:NM_001355210Re-query CCDS DB by Protein ID:NP_001342139Link to BLAST:NP_001342139.1
Original member Current member NCBI NM_008579.4 NP_032605.1 Accepted alive Link to Nucleotide Sequence:NM_008579.4Link to Protein Sequence:NP_032605.1Re-query CCDS DB by Nucleotide ID:NM_008579Re-query CCDS DB by Protein ID:NP_032605Link to BLAST:NP_032605.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001342134.1 88 Q61845 88 100% 0 0
NP_001342136.1 88 Q61845 88 100% 0 0
NP_001342137.1 88 Q61845 88 100% 0 0
NP_001342138.1 88 Q61845 88 100% 0 0
NP_001342139.1 88 Q61845 88 100% 0 0
NP_032605.1 88 Q61845 88 100% 0 0

Chromosomal Locations for CCDS 38038.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 3409195 3409323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 3411845 3411982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (267 nt):
ATGGCTACTTCTGACGTGAAACCAAAATCAATAAGTCGTGCCAAGAAATGGTCAGAGGAAATAGAAAATC
TG
TACAGATTTCAACAAGCAGGATATCGGGATGAAATTGAATATAAACAAGTGAAACAAGTTGCCATGGT
C
GACCGATGGCCAGAGACAGGGTACGTGAAGAAACTTCAGCGGAGGGACAATACTTTCTTCTACTACAAC
AAA
GAGAGGGAGTGCGAGGACAAGGAGGTCCACAAAGTGAAGGTTTACGTCTACTGA


Translation (88 aa):
MATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYN
K
ERECEDKEVHKVKVYVY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser