Display Settings:

Format

Send to:

Choose Destination
HomoloGene:99732. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_004677.3              --------------------------------------------------
XP_003951273.1           --------------------------------------------------
XP_001098872.2           --------------------------------------------------
XP_005629997.1       1   MFQHRRDIPTRPSWSGAQVAAFRPTRLKSHLSWDALEGADPRAARAPQRS   50
NP_001069109.1           --------------------------------------------------
NP_001035789.1           --------------------------------------------------
XP_420686.4              --------------------------------------------------
NP_001035406.1           --------------------------------------------------
XP_002940495.1           --------------------------------------------------


NP_004677.3              --------------------------------------------------
XP_003951273.1           --------------------------------------------------
XP_001098872.2           --------------------------------------------------
XP_005629997.1      51   SKRPHPAQGPHCVWGNRGLAGSRRRPPCERSQPPQASRACSGRGAGALPG   100
NP_001069109.1           --------------------------------------------------
NP_001035789.1           --------------------------------------------------
XP_420686.4              --------------------------------------------------
NP_001035406.1           --------------------------------------------------
XP_002940495.1           --------------------------------------------------


NP_004677.3              --------------------------------------------------
XP_003951273.1           --------------------------------------------------
XP_001098872.2           --------------------------------------------------
XP_005629997.1     101   PAGRPRAGAAAPGGGAKARGPPAAGREAPSPRPSRRAAEARRCGRPRPPG   150
NP_001069109.1           --------------------------------------------------
NP_001035789.1           --------------------------------------------------
XP_420686.4              --------------------------------------------------
NP_001035406.1           --------------------------------------------------
XP_002940495.1           --------------------------------------------------


NP_004677.3          1   -------MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPD   43
XP_003951273.1       1   -------MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPD   43
XP_001098872.2       1   -------MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPD   43
XP_005629997.1     151   PRRSGRTMEHIRTPKVENVRLVDRLSSKKAALGTLYLTATHVIFVENAPD   200
NP_001069109.1       1   -------MEHIRTPKVENVRLVDRISSKKAALGTLYLTATHVIFVETAPD   43
NP_001035789.1       1   -------MEHIRTPKVENVRLVDRVSCKKAALGTLYLTATHVIFVENAPD   43
XP_420686.4          1   -------MEHIRMPKVENVRLLDRLSSRKAAVGTLYLTATHVIFVENGSE   43
NP_001035406.1       1   -------MEHIRMPKVENVRLVDRSSSRKSQVGTLYLTATHTIFVGKGSE   43
XP_002940495.1       1   -------MEHIRLPKVENVRLLDRISSRKAALGTLYLTGTHIIFVENISE   43


NP_004677.3         44   PRKETWILHSQISTIEKQATTATGCPLLIRCKNFQIIQLIIPQERDCHDV   93
XP_003951273.1      44   ARKETWILHSQISTIEKQATTATGCPLLIRCKNFQIIQLIIPQERDCHDV   93
XP_001098872.2      44   TRKETWILHSQISTIEKQATTATGCPLLIRCKNFQIIQLIIPQERDCHDV   93
XP_005629997.1     201   TRKETWILHSQISTIEKQATTATGCPLLIRCKNFQLLQLIIPQERDCHDV   250
NP_001069109.1      44   TRKETWILHSQIATIEKQATTATGCPLLIRCKNFQLLQLIIPQERDCHDV   93
NP_001035789.1      44   TRKETWILHSQISTIEKQATTATGCPLLIRCKNFQIVQLVIPQERDCHDV   93
XP_420686.4         44   TRKETWVLHSQISSIEKQATTATGCPLLIRCKNFQVIQLVIPQERDCHDV   93
NP_001035406.1      44   DRNELWVLHSLVCNIVKHKASQSGYPLLIHCKNFQVIQFIILQESDLHNV   93
XP_002940495.1      44   TRKETWILYSQISSIEKQATATSGCPILIHCKNFQVIQLIIPQERDCHDI   93


NP_004677.3         94   YISLIRLARPVKYEELYCFSFNPMLDKEEREQGWVLIDLSEEYTRMGLPN   143
XP_003951273.1      94   YISLICLARPVKYEELYCFSFNPMLDKEEREQGWVLIDLSEEYKRMGLPN   143
XP_001098872.2      94   YISLIRLARPVKYEELYCFSFNPMLDKEEREQGWVLIDLSEEYKRMGLPN   143
XP_005629997.1     251   YISLIRLARPVKYEELYCFSFNPKLDKEEREQGWMLIDLSEEYKRMGLPN   300
NP_001069109.1      94   YISLIRLARPVKYEELYCFSFNPKLDREEREQGWMLIELSEEYKRMGLPN   143
NP_001035789.1      94   YISLIRLARPVKYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMGLPD   143
XP_420686.4         94   YISLIRLARPVKYEELYCFSFNPKLDKEEREKGWKLVNLSEEYNRMGIPN   143
NP_001035406.1      94   YISLTRLSRPEKYEELYCFSFNPAVDKAERQHSWDFIDLKAEYSRMGLPN   143
XP_002940495.1      94   YLSLVRLSRPVKYEELYCFSFKPNLDKTEHEEGWKLVDLNEEYNRMGLPK   143


NP_004677.3        144   HYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSSKFRSRRRFPVLSY   193
XP_003951273.1     144   HYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSSKFRSRRRFPVLSY   193
XP_001098872.2     144   HHWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSSKFRSRRRFPVLSY   193
XP_005629997.1     301   NYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSSKFRSRRRFPALSY   350
NP_001069109.1     144   EYWQLSDVNREYRICDSYPTELYVPKSATAHIIVGSSKFRSRRRFPALSY   193
NP_001035789.1     144   NYWQLSDVNRDYRVCDSYPTELYVPRSATAHIIVGSSKFRSRRRFPALSY   193
XP_420686.4        144   SYWQISDVNREYGVCDSYPTEVYVPKSATAHIIVGSSKFRSRRRFPALSY   193
NP_001035406.1     144   KLWHVTPINRDYRVCDTYPADLFVPKSVTLPVIVGSSKFRSRGRFPTLSY   193
XP_002940495.1     144   SLWQMSDVNRDYRVCDSYPTELYVPKSATVPIIVGSSKFRSRGRFPTLSY   193


NP_004677.3        194   YYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFVYVVDTRP   243
XP_003951273.1     194   YYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFVYVVDTRP   243
XP_001098872.2     194   YYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFVYVVDTRP   243
XP_005629997.1     351   YYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFIYVVDTRP   400
NP_001069109.1     194   YYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFLYVVDTRP   243
NP_001035789.1     194   YCKDSHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFIYVVDTRP   243
XP_420686.4        194   YCKDNNASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFIYVVDTRP   243
NP_001035406.1     194   YCKENHATICRSSQPLSGFSARCLEDEQMLQAIMKSNPGSRFMYVVDTRP   243
XP_002940495.1     194   YCQDNNASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFLYVVDTRP   243


NP_004677.3        244   KLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELK   293
XP_003951273.1     244   KLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELK   293
XP_001098872.2     244   KLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELK   293
XP_005629997.1     401   KLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRSSLQKMLEVCELQ   450
NP_001069109.1     244   KLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELK   293
NP_001035789.1     244   KLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELK   293
XP_420686.4        244   KLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCEMK   293
NP_001035406.1     244   KLNAMANRAAGKGYENEDNYCNIKFQFIGIENIHVMRNSQQKLIEVSALR   293
XP_002940495.1     244   KLNAMANRAAGKGYENEDNYSDIKFQFIGIENIHVMRNSLQKMLEVCELR   293


NP_004677.3        294   SPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWD   343
XP_003951273.1     294   SPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWD   343
XP_001098872.2     294   SPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWD   343
XP_005629997.1     451   SPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWD   500
NP_001069109.1     294   SPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWD   343
NP_001035789.1     294   SPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWD   343
XP_420686.4        294   SPSMSDFLWGLENSGWLKHIKAIMDAGIFIAKAVAEEGVSVLVHCSDGWD   343
NP_001035406.1     294   SPSMGEFLLGLENSDWLKHIRSIMEAGIFISKAVADEGVSVLVHCSDGWD   343
XP_002940495.1     294   SPSMGDFLWGLESSGWLKHIKAIIDAGIFIAKAVSEEGASVLVHCSDGWD   343


NP_004677.3        344   RTAQVCSVASLLLDPHYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPK   393
XP_003951273.1     344   RTAQVCSVASLLLDPHYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPK   393
XP_001098872.2     344   RTAQVCSVASLLLDPHYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPK   393
XP_005629997.1     501   RTAQVCSVASLLLDPHYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPK   550
NP_001069109.1     344   RTAQVCSVASLLLEPHYRTLKGFMVLIEKDWISFGHKFTHRYGNLDGDPR   393
NP_001035789.1     344   RTAQVCSVASLLLDPYYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPK   393
XP_420686.4        344   RTAQVCSVASLLLDPHYRTMKGFMVLIEKDWVSFGHKFNHRYGNLDGDPK   393
NP_001035406.1     344   RTSQVCSVASVLLDPYYRTIKGMMVLIEKDWVSFGHKFSHRCGHLDGEAK   393
XP_002940495.1     344   RTAQVCSIASLLIDPYYRTIKGFMVLIEKDWISFGHKFNHRYGNLDGDPK   393


NP_004677.3        394   EISPVIDQFIECVWQLMEQFPCAFEFNERFLIHIQHHIYSCQFGNFLCNS   443
XP_003951273.1     394   EISPVIDQFIECVWQLMEQFPCAFEFNERFLIHIQHHIYSCQFGNFLCNS   443
XP_001098872.2     394   EISPVIDQFIECVWQLMEQFPCAFEFNERFLIHIQHHIYSCQFGNFLCNS   443
XP_005629997.1     551   EISPVIDQFIECVWQLMEQFPCAFEFNERFLIHIQHHVYSCQFGNFLCNS   600
NP_001069109.1     394   EISPVIDQFLECVWQLMEQFPCAFEFNERFLIHIQHHIYSCQFGNFLCNS   443
NP_001035789.1     394   EISPVIDQFIECVWQLTEQFPCAFEFNERFLTHIQHHVYSCQFGNFLCNS   443
XP_420686.4        394   EISPVIDQFLECVWQLMEQFPCAFEFNERFLIHIQHHIYSCQFGNFLCNS   443
NP_001035406.1     394   EVSPVLDQFLECVWQLMDQFPCAFEYNEKFLISIHNHVYSSHYGNFICNS   443
XP_002940495.1     394   EVSPVIDQFIECVWQLMEQFPCAFEFNERFLVHIHHHVYSCQYGNFLCNC   443


NP_004677.3        444   QKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHSQTQGTLHLPTTPC   493
XP_003951273.1     444   QKERRELKXKEQSCILXGHLFSYRADYLNSLFRADHSQTSGNLSSPTTPC   493
XP_001098872.2     444   QKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHSQTQGTLHLPTAPC   493
XP_005629997.1     601   QKERQELKIQERTYSLWAHLWKNRADYMNPLFRADHSQTRGTLRLPTTPC   650
NP_001069109.1     444   QKERQELQIQERTYSLWAHLWKNRADYLNPLFRADHSQTRGVLHLPTAPC   493
NP_001035789.1     444   QKERRELKIQERTYSLWSNLWKNRADYLNPLFRADHSQTQGSLHLPTAPC   493
XP_420686.4        444   QKERRELKIQERTYSLWAHLWKNRADYLNPLYRPDHRQIWGTLHPQMAPC   493
NP_001035406.1     444   QKERKDLRIREKTHSIWPYLMENKLDFMNPLFKPDQIQNQGLLRPSTAP-   492
XP_002940495.1     444   QKERREIRVQERTYSLWSYLWKQRLDYMNPLYRADHSQTQGTLRPNTSPS   493


NP_004677.3        494   NFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEERLE   543
XP_003951273.1     494   AFLSRFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEERLE   543
XP_001098872.2     494   NFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEERLE   543
XP_005629997.1     651   NFMYKFWSGMYNRFEKGLQPRQSVTDYLMAVKEETQQLEEELEALEERLK   700
NP_001069109.1     494   NFMYKFWNGMYNRFEKGLQPRQSVTDYLMAVKEETQQLEEELEALEERLE   543
NP_001035789.1     494   NFTYKFWNGMYNRFEKGLQPRQSVTDYLMAVKEESQQLEEELESLEERLE   543
XP_420686.4        494   NFLYKFWSGMYNRFEKGLHPRQSVTDYLMAVKEETQQLEEELAVLGERLA   543
NP_001035406.1     493   -YCFKYWRRLYNRFDRELHPRQSELDCLMAVKDETQQLEEEMALYEQKLA   541
XP_002940495.1     494   NFKYKFWRGLYNRFEKGMQPRQSVTDFLQAVKEETQQLEEELEFMQKRWQ   543


NP_004677.3        544   KIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSR-   592
XP_003951273.1     544   KIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSR-   592
XP_001098872.2     544   KIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSR-   592
XP_005629997.1     701   KIQKVQLNHTKVKSKPSEPSKHSGFSTSDNSTANTPQDYSGNMKSFPSR-   749
NP_001069109.1     544   KIQKVQLNRTKVRSKQSEPSKHSGFSTSDNSAANTPQDYSGNVKSFPSR-   592
NP_001035789.1     544   KIQKVHLHGTKVKSKQSEPSKHSGFSTSDHSTANTPQDYSGNSKSFPSR-   592
XP_420686.4        544   NLQKLQLNGNKVKSKQQDRSKELALSASSNSLANTPQEYSNDLKSFPSR-   592
NP_001035406.1     542   VLDKERAKILYMQKGVLESRQALWSVPLDVSLANTPQDYLGGFIGGAPNV   591
XP_002940495.1     544   KFESQHLNGTKSFNEIHESDK-LQICATAYTSANSPQDYSSTLKSFPSR-   591


NP_004677.3        593   -SPSQGD-EDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEH   640
XP_003951273.1     593   -SPSQGD-EDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEH   640
XP_001098872.2     593   -SPSQGD-EDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEH   640
XP_005629997.1     750   -SPSQGD-EDSALILTQDNLKSSDLDLSANSDQESGVEDLSCRSPSGGEC   797
NP_001069109.1     593   -SPSQGD-EDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEC   640
NP_001035789.1     593   -SPSQGD-EDSALILTQDNLKSSDPDLSVNSDQESGVEDLSCRSPSGGEH   640
XP_420686.4        593   -SPSQGDEEDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSAGGC   641
NP_001035406.1     592   FTSQQGEKESTEFSLFGDKPKSSDAE---NSDQESGVADFSCHS-SGEES   637
XP_002940495.1     592   -SPSQGE-EDSALILTQEHLKSSDPDLSANSDQESGVEDLSCRSPSGGDS   639


NP_004677.3        641   APSEDSGKDRDSDEAVFLTA   660
XP_003951273.1     641   APSEDSGKDRDSDEAVFLTA   660
XP_001098872.2     641   APSEDSGKDRDSDEAVFLTA   660
XP_005629997.1     798   APSEDSGKDRDSDEAVFLTA   817
NP_001069109.1     641   VPSEDSGKDRDSDEAVFLTA   660
NP_001035789.1     641   APSEDSGKDRDSDEAVFLTA   660
XP_420686.4        642   LPSEDSGK--DSDEAVCLAV   659
NP_001035406.1     638   LPSEDSVK--DSDETGHNRA   655
XP_002940495.1     640   LPSEDSGKDPDSDEAMFLNA   659


Protein Acc. Gene Organism
NP_004677.3 MTMR7 H.sapiens
XP_003951273.1 MTMR7 P.troglodytes
XP_001098872.2 MTMR7 M.mulatta
XP_005629997.1 MTMR7 C.lupus
NP_001069109.1 MTMR7 B.taurus
NP_001035789.1 Mtmr7 M.musculus
XP_420686.4 MTMR7 G.gallus
NP_001035406.1 mtmr7a D.rerio
XP_002940495.1 mtmr7 X.tropicalis


Support Center