Display Settings:

Format

Send to:

Choose Destination
HomoloGene:925. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001189.2          1   MLDICLEKRVGTTLAAPKCNSSTVRFQGLA-EGTKGTMKMDMEDADMTLW   49
XP_518658.2          1   MLDICVEKRVGTTLAAPKCNSSTVRFQGLA-EGTKGTMKMDMEDADMTLW   49
XP_001087708.1       1   MLDICLEKRVGTTLAAPKCSSSTVRFQGLA-EGTKGTMKMDMEDADMTLW   49
XP_005627729.1       1   MRDLCSETRAGTPSAAPKCSSSAVRSPRLS-D---GTMKMDMEDADMTLW   46
NP_001179865.1       1   MLDICLEKRVGTTLAAPKCSSSAVKVPGLA-EGTEGTMKMDMEDADMTLW   49
NP_031574.2          1   MLDLLLEKRVGTTLAAPKSSSGSVKFQGLA-E-T-GIMKMDMEDADMTLW   47
NP_001101109.2       1   MLDLLLEKRVGTTLAAPKCNSGSVKFQGLA-E-TSGIMKMDMEDADMTLW   48
XP_004940411.1       1   -------------MAATRCSSDAVSFKNLV-KGREWTMKMDMEDADMTLW   36
NP_955809.2          1   ------MCGWDQSVLAPYQNSAMLTTEAAPYTADNEELKMDVEDVDMTKW   44
XP_004914605.1       1   -------------------------------------MKMDMEGIDMTLW   13


NP_001189.2         50   TEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYAT-NSEEV   98
XP_518658.2         50   TEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYAT-NSEEV   98
XP_001087708.1      50   TEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYAT-NSREV   98
XP_005627729.1      47   TEAEFEEKCTYIVNDHPWDCGADGGASVQAEASLPRNLLFKYGP-SSKEV   95
NP_001179865.1      50   TEAEFEEKCTYIVNDHPWDSGVEGGTSVQAEASLPRNLLFKYAT-NSKEI   98
NP_031574.2         48   TEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYAANNSKEV   97
NP_001101109.2      49   TEAEFEEKCTYIVNDHPWDSSADGGTSVQAEASLPRNLLFKYAANNSKEV   98
XP_004940411.1      37   TEADFEEKCTYIVNDHPWDPSADGGTLTQAEASLPRNLTFKYAS-NCKEV   85
NP_955809.2         45   TEDEFEEKCTYIVKDHTWEGPLENTDLTRAEASLPRNLAFKHPA-DSKEV   93
XP_004914605.1      14   SETEFEEKCTYIVKDHSSDSSSEGSNVAQAQASLPRNLLFKYAS-GCKEV   62


NP_001189.2         99   IGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFI   148
XP_518658.2         99   IGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFI   148
XP_001087708.1      99   IGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFI   148
XP_005627729.1      96   IGVVSKEYIPKGTRFGPLIGEIYTNDTVPKNANRIYFWRIYSRGELLHFI   145
NP_001179865.1      99   TGVVSKEYIPKGTRFGPLIGEIYTSDAVPKNANRKYFWRIYSRGELHHFI   148
NP_031574.2         98   IGVVSKEYIPKGTRFGPLIGEVYTNDTVPKNANRKYFWRIYSREEFHHFI   147
NP_001101109.2      99   IGVVSKEYIPKGTRFGPLIGEVYTNDTVPKNANRKYFWRIYSREEFHHFI   148
XP_004940411.1      86   TGVISKEYIPKGTRFGPLVGEIYTSDTVPKNANRKYFWRIYSSGELHHFI   135
NP_955809.2         94   IGVVSREYIPKGTRFGPLVGESYTAENVPKDANRKYFWRIYSDGEFHHFV   143
XP_004914605.1      63   IGVVSKEYIPKGTRFGPLVGEIYTNDTVPKNANRKYFWRIYSNGEFQHFI   112


NP_001189.2        149   DGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLV   198
XP_518658.2        149   DGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLV   198
XP_001087708.1     149   DGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLV   198
XP_005627729.1     146   DGFNEEKSNWMRYVNPARSAREQNLAACQNGMNIYFYTIKPIPANQELLV   195
NP_001179865.1     149   DGFNEEKSNWLRYVNPAHTAREQNLAACQNGMNIYFYTIKPIPANQELLV   198
NP_031574.2        148   DGFNEEKSNWMRYVNPAHSAREQNLAACQNGMNIYFYTIKPIPANQELLV   197
NP_001101109.2     149   DGFNEEKSNWMRYVNPAHSAREQNLAACQNGMNIYFYTIKPIPANQELLV   198
XP_004940411.1     136   DGFNEDKSNWMRYVNPGYSVQEQNLAACQNGMNIYFYTIKPIPANQELLV   185
NP_955809.2        144   DGLDEEKSNWMRYVNPAHSQQEQNLAACQNGMNIYFYTVKAIPADQELLV   193
XP_004914605.1     113   DGYNEDKSNWMRYVNPAHSLQEQNLAACQNGMNIYFYTIKPIPANQELLV   162


NP_001189.2        199   WYCRDFAERLHYPYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKREY   248
XP_518658.2        199   WYCRDFSERLHYPYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKREY   248
XP_001087708.1     199   WYCRDFAERLHYPYPGELTMMNLTQTQSNLKQPSTEKNELCPKNVPKREH   248
XP_005627729.1     196   WYCRDFAERLHYPYPGELTMMSLTQTQSHPKQPGAEKNDLCPKNAPKREY   245
NP_001179865.1     199   WYCRDFAERLHYPYSGELTMMNLTQTQSRPKQQSTEKHELCPKSVPKREY   248
NP_031574.2        198   WYCRDFAERLHYPYPGELTVINLTQTESNPKQYSSEKNELYPKSVPKREY   247
NP_001101109.2     199   WYCRDFAERLHYPYPGELTVMNLTQTESNPKQYSSEKNELYPKSVPKREY   248
XP_004940411.1     186   WYCRDFAERLHYPSSRELTMMNLTQTHVNPKQHSADKDELYQKSVPKKEH   235
NP_955809.2        194   WYCPEFARRLNYPASGEIMMQKLKQSLIEAKQQATE-----VKHPVKREH   238
XP_004914605.1     163   WYCRDFADRLHYPTSGEL-VVNLQQSLTIREEKRKELTQ--QKNTPKKEH   209


NP_001189.2        249   SVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRRGSPEMPFYPRVV   298
XP_518658.2        249   SVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRHGSPEMPFYPRVV   298
XP_001087708.1     249   SVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRHGSPEMPFYPRVV   298
XP_005627729.1     246   SVKEILKLDSHPPRGKDCYRSNISPFAAERDADDLGKNGSPEMPFYPRAV   295
NP_001179865.1     249   SVKEILKLDSHPSKGKDLYRSNISPLTSEKDAEDFRKNGSPEMPFYPRVV   298
NP_031574.2        248   SVKEILKLDSNPSKRKDIYRSNISPFTLEKDMDGFRKNGSPDMPFYPRVV   297
NP_001101109.2     249   SVKEILKLDSNPSKRKDSYRSNISPYTSEKDMDGFRKNGSPDMPFYPRVV   298
XP_004940411.1     236   SVKEILKMESSPPKGKDFFQTNISPVTPEKDLDDLRKNYSPERCFFPRVV   285
NP_955809.2        239   SVSEIL---------KDVLQEPSRPLPTRP-----RCPKSPDRPLYPSAV   274
XP_004914605.1     210   SVKEILRDTTSHLKHKDNLLSSMSAITPEKEKVDVHKNCSPERTFFPRVV   259


NP_001189.2        299   YPIRAPLPEDFLKASL-AYGIERPTYITRSPIPSSTTPSPSARSSPDQSL   347
XP_518658.2        299   YPIRAPLPEDFLKASL-AYGIERPTYITRSPIPSSTTPSPSARSSPDQSL   347
XP_001087708.1     299   YPIRAPLPEDFLKASL-AYGMERPTYITRSPIPSSTTPSPSARSSPDQSL   347
XP_005627729.1     296   YPSRVPLPEDFLK----AYGMERPTYIARSPLPSSTTPSPSARSSPDQSL   341
NP_001179865.1     299   YPIRAPLPEDFLKAPLGCYGMERPPYITHSPISSSTTPSPSARSSPDRSL   348
NP_031574.2        298   YPIRAPLPEDFLKASL-AYGMERPTYITHSPLPSSTTPSPPASSSPEQSL   346
NP_001101109.2     299   YPIRAPLPEDFLKASL-AYGMERPTYITHSPLPSSTTPSPPASSSPEQSL   347
XP_004940411.1     286   YPIRPHIPEDYLKASL-AYGMDRPSYITHSPIQSSTTPSPSGRSSPDQSL   334
NP_955809.2        275   YPPRPSLNEDFLKSTT-VFGLP-----TRSHTQCSVTPSPSAHSSPER--   316
XP_004914605.1     260   YPFPSHIHEDYLKASV-GYNMDRQNYLMHSPIQPSTTPSPSSRSSPDQSF   308


NP_001189.2        348   KSSSPHSSPGNTVSPVGPGSQEHRDSYAYLNASYG--TEGLGSYPGYAPL   395
XP_518658.2        348   KSSSPHSSPGNTVSPVGPGSQEHRDSYAYLNAPYG--TEGLGSYPGYAPL   395
XP_001087708.1     348   KSSSPHSSPGNTVSPVGPGSQEHRDSYAYLNAPYG--TEGLGSYPGYAPL   395
XP_005627729.1     342   QSCSPHSSPGDTVSPLAPCGPDHRDSYAYLNAPYG--PEGLGAYPGFAPG   389
NP_001179865.1     349   QSCSPHSSPGNTVSPRAPGPQEARDSYAYLNAPYGAAAEGLGSLAGYGPP   398
NP_031574.2        347   KSSSPHSSPGNTVSPLAPGLPEHRDSYSYLNVSYG--SEGLGSYPGYAPA   394
NP_001101109.2     348   KSASPHGSPGNTVSPVVPGPPEHRDSYSYLNVSYG--SEGLGSYPGYAPA   395
XP_004940411.1     335   KSSSPHSSPGVTVSPLAPTSQEHRESYSYLNGSYG--SEGLGSYPGYAPP   382
NP_955809.2        317   -------SPGS--SPTSASIEPREAFLPFSPALYN---RGLNHYPGYSPA   354
XP_004914605.1     309   KSSSPHSSPGSAVSPHHP-LQDHKEFYPFINRPYN--TEGLGSFPTYAPP   355


NP_001189.2        396   PHLPPAFIPSYNAHYPKFLLPPYGMNCNGL-SAVSSMNGINNFGLFPRLC   444
XP_518658.2        396   SHLPPAFIPSYNAHYPKFLLPPYGMNCNGL-SAVSSMNGINNFGLFPRLC   444
XP_001087708.1     396   PHLPPAFIPSYNAHYPKFLLPPYGMNCNGL-SAVSSMNGINNFGLFPRLC   444
XP_005627729.1     390   PPLPPAFLPSYNAHYPKFLLPPYGVGCPGL----GGVGGVGGLSLFPRLY   435
NP_001179865.1     399   THLPPAFIPSYNAHYPKFLLPPYGMNCNGLGAAVSNINGLNSFGLFPRLY   448
NP_031574.2        395   PHLPPAFIPSYNAHYPKFLLPPYGISSNGL-STMNNINGINNFSLFPRLY   443
NP_001101109.2     396   PHLPPAFIPSYNAHYPKFLLPPYGISSNGL-STMNNINGINNFSLFPRLY   444
XP_004940411.1     383   SHLPSAFLPSYNPHYPKFLLPPFNMSCNNL-SALNNINGINNFNLFPRMY   431
NP_955809.2        355   GSMP--FYP--NPHYSRYLMHHYPVSS--L-SGPSTLGGI-----FPHMY   392
XP_004914605.1     356   TSHLPPFVSSYNSTYSKYLLPPYGIGCNGL-NSLNNINAINNFNPFSRMY   404


NP_001189.2        445   PVYSNLL--------GGGSLPHPMLNPTSLPSSLPSDGARR-LLQPEH--   483
XP_518658.2        445   PVYSNLL--------GGGSLPHPMLNPTSLPSSLPSDGARR-LLQPEH--   483
XP_001087708.1     445   PVYSNLL--------GGGSLPHPMLNPTSLPSSLPSDGARR-LLQPEH--   483
XP_005627729.1     436   PVYGGLLGGGGGGGGGGGGLPHPLLGPASLPGSLPSDAARR-PLQPDH--   482
NP_001179865.1     449   PVYSSLL--------GGGGLPPPVLASASLPSSLPSEGARR-LLQPEH--   487
NP_031574.2        444   PVYSNLL--------SGSSLPHPMLNPASLPSSLPTDGARR-LLPPEH--   482
NP_001101109.2     445   PVYSNLL--------SGGNLPHPMLNPASLPSSLPTDGARR-LLPPEH--   483
XP_004940411.1     432   PLYGNLL--------SGGSLSHHMLNPTTLPSSLPSEGGRR-LLQPDH--   470
NP_955809.2        393   PFYSSLV-------------PPHVPFP---PSMLSSEGSRQFMLPPDSPA   426
XP_004914605.1     405   PVYSSML--------AGGSLPHHLLTHAALPGSLPHEGGRR-LLQPEL--   443


NP_001189.2        484   PREVLVPAPHSAFSFTGAAASMKDK-------ACSPTSGSPTAGTAATAE   526
XP_518658.2        484   PREVLVPAPHSAFSLTGAAASMKDK-------ACSPTSGSPTAGTAATAE   526
XP_001087708.1     484   PREVLVPAPHSAFSLTGAAASMKDK-------ACSPTSGSPTAGTAATAE   526
XP_005627729.1     483   ARQVLIPAPHSAFSLPAAAASMKDR-------ASSPASGSPTAGTAASAE   525
NP_001179865.1     488   PREVLVPAPHSAFSLPGAAASLKDK-------ACTPTSGSPTAGTAATAE   530
NP_031574.2        483   PKEVLIPAPHSAFSLTGAAASMKDE-------S-SPPSGSPTAGTAATSE   524
NP_001101109.2     484   PREVLVPAPHSAFSLTGAAASMKDE-------S-SPPSGSPTAGTAATSE   525
XP_004940411.1     471   PRDFLIPAPNSAFSITGAAASMKDK-------PCSPTSGSPTAGTAASSE   513
NP_955809.2        427   PRDILLPAATSAFS---AATSLKDKPLHGHGHPYAPAGGSPTAGSAASTG   473
XP_004914605.1     444   PRDFLIPAPNSAFSITGAAASMKDK-------QSSPTSGSPTAGTAASLE   486


NP_001189.2        527   HVVQPKATSAAMAAP-SSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKY   575
XP_518658.2        527   HVVQPKATSAAMAAP-SSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKY   575
XP_001087708.1     527   HVVQPKATSAAMAAP-SSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKY   575
XP_005627729.1     526   HVVQPHATSAALAAP-GGDEAVNLMKSKRNMTGYKTLPYPLKKQNGKIKY   574
NP_001179865.1     531   HVVQPKATSAAAAAP-GGEEAVNLIKNKRNMTGYKTLPYPLKKQNGKIKY   579
NP_031574.2        525   HVVQPKATSSVMAAP-STDGAMNLIKNKRNMTGYKTLPYPLKKQNGKIKY   573
NP_001101109.2     526   HVVQPKATSSVMAAP-STDGAMNLIKNKRNMTGYKTLPYPLKKQNGKIKY   574
XP_004940411.1     514   HIMQPKPTSVVLAAT-GGEEAMNLIKSKRNVTGYKTLPYPLKKQNGKIKY   562
NP_955809.2        474   -CIPTKPTSAILSTSRSEDEAINLSKMKRGSTGYKSLDYPLKKQNGKIKY   522
XP_004914605.1     487   HIMQPKPTSAVMST--SSEEAINLIKSKRNMTGYKTLPYPLKKQNGKIKY   534


NP_001189.2        576   ECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   625
XP_518658.2        576   ECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   625
XP_001087708.1     576   ECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   625
XP_005627729.1     575   ECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   624
NP_001179865.1     580   ECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   629
NP_031574.2        574   ECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   623
NP_001101109.2     575   ECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   624
XP_004940411.1     563   ECNVCSKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   612
NP_955809.2        523   ECNVCTKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVH   572
XP_004914605.1     535   ECNVCSKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHFLVH   584


NP_001189.2        626   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK   675
XP_518658.2        626   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK   675
XP_001087708.1     626   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK   675
XP_005627729.1     625   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK   674
NP_001179865.1     630   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK   679
NP_031574.2        624   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK   673
NP_001101109.2     625   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK   674
XP_004940411.1     613   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLK   662
NP_955809.2        573   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKICPAKFTQFVHLK   622
XP_004914605.1     585   TGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLK   634


NP_001189.2        676   LHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNC-AAAPAPGLPLEDLT   724
XP_518658.2        676   LHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNC-AVAPAPGLPLEDLT   724
XP_001087708.1     676   LHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNC-AAAPAPGLPLEDLT   724
XP_005627729.1     675   LHKRLHTRERPHKCAHCHKSYIHLCSLKVHLKGNC-PVAPATGMPLEDLT   723
NP_001179865.1     680   LHKRLHTRERPHKCAHCHKSYIHFCSLKVHLKGHC-PVAPATGLPLEDLA   728
NP_031574.2        674   LHKRLHTRERPHKCAQCHKSYIHLCSLKVHLKGNC-PAGPAAGLPLEDLT   722
NP_001101109.2     675   LHKRLHTRDRPHKCAQCHKSYIHLCSLKVHLKGNC-PVVPAPGLPLEDLT   723
XP_004940411.1     663   LHKRLHTRERPHKCIHCHKSYIHLCSLQVHLKGNC-PVAPASGLSMEDLN   711
NP_955809.2        623   LHKRLHTRERPHQCPHCHHNYIHLSSLRFHLKGYCLAVSPSPSCSLDELN   672
XP_004914605.1     635   LHKRLHTRERPHKCIHCHKSYIHLCSLNFHMKGNC-PVSPRLGVSREDLN   683


NP_001189.2        725   RINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKE--ETGL   772
XP_518658.2        725   RINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKE--ETGL   772
XP_001087708.1     725   RINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKE--ETGL   772
XP_005627729.1     724   RINEEIEKFDISDNADRLEDMED-IDVTSVVEKEILAVVRKEKE--ETGL   770
NP_001179865.1     729   RINEEIEKFDISDNADRLEDMEDNIDMTSVVENEILAVVRKEKE--ETGL   776
NP_031574.2        723   RINEEIERFDISDNADRLEDMEDSVDVTSMVEKEILAVVRKEKE--ETSL   770
NP_001101109.2     724   RINEEIERFDLSDNADRLEDMEDSVDVTSMVEKEILAIVRKEKE--ETGL   771
XP_004940411.1     712   RINEEIEKFDISDNADKLEEVEDNIDLTSIVEKDILTVLRREME--GANL   759
NP_955809.2        673   RVNEEIERFDISDNADRLEEMEG-FDVEGMVEKQIFGLLWQEMDFKASYH   721
XP_004914605.1     684   RMNEEIEKFDISDSADRLDDMED-MDMSPAVEKEIMTLLRREID--GASM   730


NP_001189.2        773   KVSLQRNMG-NGLLSSGCSLYES-SDLPLMKLPPSNPLPLVPVKVKQETV   820
XP_518658.2        773   KVSLQRNMG-NGLLSSGCSLYES-SDLPLMKLPPSNPLPLVPVKVKQETV   820
XP_001087708.1     773   KVSLQRNMG-NGLLSSGCSLYES-SDLPLMKLPPSNPLPLVPVKVKQETV   820
XP_005627729.1     771   KVSLQRNMG-NGLL-SGCSLYES-SDPSLMKLAHSNPLPLGPVKVKQETV   817
NP_001179865.1     777   KASLQRNLG-NGLL-SGYNLYES-TEPSLLKLPHSNPLPLGPVKVKEETV   823
NP_031574.2        771   KVSLQRNMG-NGLLSSGCSLYES-SDLSLMKLPHSNPLPLVPVKVKQETV   818
NP_001101109.2     772   KMSLQKTMG-SRLPSSGCSLYES-SDLSLMKLPHSNSLPLVPVKVKQETV   819
XP_004940411.1     760   KVSLQRNLG-NGLISSGCNLYES-SDMSIMKLPHSHPLPLLPVKVKQETV   807
NP_955809.2        722   KGSTGGDLHPRAPALSAYHLNEHDSEASVIKVHRSSPIQLLPIKVKKETE   771
XP_004914605.1     731   KMSVSRNVGNNGLLTSGCNFYDR-SDAVVTKLPLSSPLPLLPVKVKQESI   779


NP_001189.2        821   EPMDP   825
XP_518658.2        821   EPMDP   825
XP_001087708.1     821   EPMDP   825
XP_005627729.1     818   EPMDP   822
NP_001179865.1     824   EPMDP   828
NP_031574.2        819   EPMDP   823
NP_001101109.2     820   EPMDP   824
XP_004940411.1     808   EPMDP   812
NP_955809.2        772   EAMDT   776
XP_004914605.1     780   DQMDS   784


Protein Acc. Gene Organism
NP_001189.2 PRDM1 H.sapiens
XP_518658.2 PRDM1 P.troglodytes
XP_001087708.1 PRDM1 M.mulatta
XP_005627729.1 PRDM1 C.lupus
NP_001179865.1 PRDM1 B.taurus
NP_031574.2 Prdm1 M.musculus
NP_001101109.2 Prdm1 R.norvegicus
XP_004940411.1 PRDM1 G.gallus
NP_955809.2 prdm1a D.rerio
XP_004914605.1 prdm1 X.tropicalis


Support Center