Display Settings:

Format

Send to:

Choose Destination
HomoloGene:9125. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001139786.1       1   -------------------------------------MAASVEQREGTIQ   13
XP_003309869.1       1   ----MLLWDCHPGQGVLWPLIIVALNHRPFTSTAAAGMAASVEQREGTIQ   46
NP_001165336.1       1   -------------------------------------MAASVEQHEGTIQ   13
XP_541860.3          1   --------------------------------------MAGVEQQEGTIQ   12
NP_001098911.1       1   --------------------------------------MAGVEQREGAIQ   12
NP_083907.3          1   --------------------------------------MAGVDQHEGTIK   12
NP_001007665.1       1   --------------------------------------MANVELSEGTIQ   12
NP_956661.1          1   --------------------------------------MSSVEISEGSVL   12
NP_500027.1          1   MVLLHHQPLGSHHATTSGGSLLERADLSHPIPENARKLAQLVEYDESRVE   50
NP_001017276.1       1   --------------------------------------MAEVQIKESTVK   12


NP_001139786.1      14   VQ---GQALFFREALPGSGQ-ARFSVLLLHGIRFSSETWQNLGTLHRLAQ   59
XP_003309869.1      47   VQ---GQALFFREALPESGQ-ARFSVLLLHGIRFSSETWQNLGTLHRLAQ   92
NP_001165336.1      14   VQ---GQALFFREARPSSGQ-AHFSVLLLHGIRFSSETWQNLGTLHRLAQ   59
XP_541860.3         13   VQ---GQSLFFREGRPGGGQAASFSVLLLHGIRFSSETWQKLGTLHKLAQ   59
NP_001098911.1      13   VQ---GQSLFFREALPGGGQAARFSVLLLHGIRFSSETWQNLGTLHRLAQ   59
NP_083907.3         13   VQ---GQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAE   59
NP_001007665.1      13   VR---GQSLFFREARPGNGQAVRFSVLLLHGIRFSSETWQNLGTLHRLAE   59
NP_956661.1         13   LEICGDQPLFYRQAVPSSGS-GGLCVLLLHGIRFSSKNWQKIGTLETLAA   61
NP_500027.1         51   LG---THSVFVREARPPGAHYSKATVIFLHGQSFSSSTWTENNLLRTFAA   97
NP_001017276.1      13   VS---GQTLFYREALPVAPGTNKPPVLLLHGIRFSSQEWQNLKTLHTLAA   59


NP_001139786.1      60   AGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVIS   109
XP_003309869.1      93   AGYRAVAIDLPGLGRSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVIS   142
NP_001165336.1      60   AGYQAVAIDLPGLGHSKEAAAPVPIGELAPGSFLAAVVDALELGPPVVIS   109
XP_541860.3         60   AGYRAVAIDLPGLGRSKEAVAPAPIGELVPSSFLAAVVDALDLGSPVVIS   109
NP_001098911.1      60   AGYRAVAIDLPGLGRSKEAKAPAPIGELVPSSFLAAVVDALDLGPPVVIS   109
NP_083907.3         60   AGYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVIS   109
NP_001007665.1      60   AGYRAVAIDLPGLGRSKEAAAPAPIGELAPGSFLAAVVDALELGSLVVIS   109
NP_956661.1         62   AGYRALAIDLPGLGQSKAAVAPAAVGELAPAVFLRQVCEGLQTGPVVIIS   111
NP_500027.1         98   LGYRAIAIDLPGSGQTRGAAIP----QAEKPNFLMDFIETLGLKQVMIVC   143
NP_001017276.1      60   AGHRAVALDLPGLGHSADAVAPSPLGELAPPGFLQEVLESLNMVPAVLIS   109


NP_001139786.1     110   PSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYG   159
XP_003309869.1     143   PSLSGMYSLPFLTAPGSQLPGYVPVAPICTDKINAANYASVKTPALIVYG   192
NP_001165336.1     110   PSLSGMYSLPFLTAPGSQLRGYVPVAPICTDKINAANYASVKTPALIVYG   159
XP_541860.3        110   PSLSGMYSLPFLTAPGSQLRGYVPVAPICTDKINAADYASVKTSTLIVYG   159
NP_001098911.1     110   PSLSGMYSLPFLTAPGSQLRGYVPVAPICTDKINAADYARVKASVLIVYG   159
NP_083907.3        110   PSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYG   159
NP_001007665.1     110   PSLSGMYALPFLVAPESQLRGYVPVAPICTDKINAADYARVKTPTLIVYG   159
NP_956661.1        112   PSLSGMYSLPFLFQHSELLKAYIPVAPICTEKFTAEQYGSIQTPALIVYG   161
NP_500027.1        144   ASMAAQYVLPLMTST-RHLSCVVLVAPSNTHEVVSP--SSYTVPTLVVWG   190
NP_001017276.1     110   PSLSGMYSLPFLLSSPQSVAAYVPVAPICTDKFSVQDYAHVQVPALIVYG   159


NP_001139786.1     160   DQD-PMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQG   208
XP_003309869.1     193   DQD-PMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQG   241
NP_001165336.1     160   DQD-PMGQSSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQG   208
XP_541860.3        160   DQD-PMGLTSFEHLKQLPNHRVLVMEGAGHPCYLDKPEEWHTGLLDFLQG   208
NP_001098911.1     160   DQD-PMGQTSFEHLKQLPNHRVLVMEGAGHPCYLDKPEEWHTGLLDFLQG   208
NP_083907.3        160   DQD-PMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQG   208
NP_001007665.1     160   DQD-PMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHTGLLDFLQE   208
NP_956661.1        162   DQDTQLGEVSLNNLSQLPNHRVVVMKGAGHPCYLDDPETWHKAVLDFLQQ   211
NP_500027.1        191   ERDTSLGPTAAANLKNLPQVKLQKIPDAGHACYLHNPKCFENLCVNFFDL   240
NP_001017276.1     160   DKDEQLGELSLRNLKNLPNHRVFCMKGAGHACYLDDPDTWHQGLMEFLSS   209


NP_001139786.1     209   LQ----   210
XP_003309869.1     242   LQ----   243
NP_001165336.1     209   LQ----   210
XP_541860.3        209   LA----   210
NP_001098911.1     209   LA----   210
NP_083907.3        209   LA----   210
NP_001007665.1     209   LA----   210
NP_956661.1        212   LR----   213
NP_500027.1        241   IRSYHH   246
NP_001017276.1     210   LK----   211


Protein Acc. Gene Organism
NP_001139786.1 ABHD14B H.sapiens
XP_003309869.1 ABHD14B P.troglodytes
NP_001165336.1 ABHD14B M.mulatta
XP_541860.3 ABHD14B C.lupus
NP_001098911.1 ABHD14B B.taurus
NP_083907.3 Abhd14b M.musculus
NP_001007665.1 Abhd14b R.norvegicus
NP_956661.1 abhd14b D.rerio
NP_500027.1 Y55F3AM.10 C.elegans
NP_001017276.1 abhd14b X.tropicalis


Support Center