Display Settings:

Format

Send to:

Choose Destination
HomoloGene:87012. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_067382.1          1   MSPLLLWLGLMLCVSGLQAGDEEEHKCFLEGENLTLTCPYNIMLYSLSLK   50
NP_001178510.1       1   MSPLLLWLGLLLCVSGLKDGDEEEQKCFLKGENLTLTCPYNIMLHSSSLK   50


NP_067382.1         51   AWQRVRSHGSPETLVLTNTRKADFNVARAGKYLLEDYPTESVVKVTVTGL   100
NP_001178510.1      51   AWQRVRSHGSPETLVITNTRKPDFNVARAGRYLLEDYPTESIVKVTMTEL   100


NP_067382.1        101   QRQDVGLYQCVVYLSPDNVIILRQRIRLAWCQGK--PVMVIVLTCGFILN   148
NP_001178510.1     101   QKQDVGLYQCVIYLSPNNVVILYHRIRLVWCQEQWVTVMVIVLTCGFILN   150


NP_067382.1        149   KGLVFSVLFVFLCKAGPKVLQPSKTSKVQGVSEKQ   183
NP_001178510.1     151   KGLVFSVLFVLLCKAGPKVLQPSKTSKVQGASEKQ   185


Protein Acc. Gene Organism
NP_067382.1 Trem3 M.musculus
NP_001178510.1 Trem3 R.norvegicus


Support Center