Display Settings:

Format

Send to:

Choose Destination
HomoloGene:86179. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_005635867.1           --------------------------------------------------
XP_005203082.1           --------------------------------------------------
NP_001075215.1           --------------------------------------------------
XP_003084503.1           --------------------------------------------------
XP_001477761.1           --------------------------------------------------
XP_003085582.1           --------------------------------------------------
XP_001474281.1           --------------------------------------------------
NP_291094.2              --------------------------------------------------
XP_006245550.1       1   MPSNVIVPLQRALSSPCARTQIRAGKHTRSFRQSHPFRSFSLPGAKPARK   50


XP_005635867.1       1   -MNLSSEHCNISDWLRLEATVKASVYMVAFFFTTFVTVIIITIVSQNSKL   49
XP_005203082.1       1   -MNVSSEHCNMSDWLRLEATVKASVYVVAFSFATLITVIIITIVLQNSKL   49
NP_001075215.1       1   -MNSSSEHCNVSDWLRLEATVKASVYVVAFSITTSLTVVIIAIVSQSLQL   49
XP_003084503.1       1   -MNSSSEHCNVSDWLRLEATVKASVYVVAFSITTSLTVVIIAIVSQSLQL   49
XP_001477761.1       1   -MNSSSEHCNISDWLRLEATVKASVYVVAFSITTSLTFVIIAIVSQSLQL   49
XP_003085582.1       1   -MNSSSEHCNISDWLRLEATVKASVYVVAFSITTSLTFVIIAIVSQSLQL   49
XP_001474281.1       1   -MNSSSEHCNVSDWLRLEATVKASVYVVAFSITTSLTIVIIAIVSQSLQL   49
NP_291094.2          1   -MNSSSEHCNVSDWLRLEATVKASVYVVAFSITTSLTIVIIAIVSQSLQL   49
XP_006245550.1      51   TMNSSSEHCNISDWLRLEATVKASVYVVAFSVATSITVVIIATVSQSLQL   100


XP_005635867.1      50   KKEVRYVLLCHHLLCISSYCGLGVVFQGMRALLANSPVLMCWVVFGVQLS   99
XP_005203082.1      50   RKEVRYILLCHHLLCISSYCGLGVVFQGMRAFLANSPVLVCWVVFGAQLS   99
NP_001075215.1      50   RKEVPLVLLCHHLLCISSYCGLGVVFQGMRALLANSPLLLCWLVFGAQLS   99
XP_003084503.1      50   RKEVRLVLLCHHLLCISSYCGLGVVFQGMRALLANSPLLLCWLVFGAQLS   99
XP_001477761.1      50   RKEVRLVLLCHHLLCISSYCGLGVVFQGMRALLANSPLLLCWLVFGAQLS   99
XP_003085582.1      50   RKEVRLVLLCHHLLCISSYCGLGVIFQGMRALLANSPLLLCWLVFGAQLS   99
XP_001474281.1      50   RKEVRLVLLCHHLLCISSYCGLGVVFQGMGALLANSPLLLCWLVFGAQLS   99
NP_291094.2         50   RKEVRLVLLCHHLLCISSYCGLGVVFQGMRALLANSPLLLCWLVFGAQLS   99
XP_006245550.1     101   REEVRLVLLCHHSLCVSSYCGLGVVFQGMRAFLANSPLLLCWLVFGAQLS   150


XP_005635867.1     100   VGEGILFTLALMAVNTYLAICWPLKSLSFVDSVKYRILAGSWIIIIFKNV   149
XP_005203082.1     100   VGEGILFTLALMAAHTYLVICWPLTSVSFVDSVKYKILAGTWLIIILKNA   149
NP_001075215.1     100   VGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRILAGTWTTVILKNV   149
XP_003084503.1     100   VGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRILAGTWTTVILKNV   149
XP_001477761.1     100   VGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRILAGTWTTVILKNV   149
XP_003085582.1     100   VGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRILAGTWTTVILKNV   149
XP_001474281.1     100   VGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRILAGTWTTVILKNV   149
NP_291094.2        100   VGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRILAGTWTTVILKNV   149
XP_006245550.1     151   VGEGILLTLTLMALNTYLGICYPLRSPSLVDSAKYRILAGTWTTVILKNA   200


XP_005635867.1     150   CLFLIEGTTSTQVAVLKSEPLCPVILNGSAARAIGMVFLFFLLFIILISY   199
XP_005203082.1     150   CLFLIEGTGPTQIALLKSEPLCPVVLNGILARAIGMVFLFLLLSIILVSY   199
NP_001075215.1     150   GLFLIEGTSPTPASVFQSAPLCPVILNGMPARVIGMFSLAFLLSVILVSY   199
XP_003084503.1     150   GLFLIEGTSPTPASVFQSAPLCPVILNGMPARVIGMFSLAFLLSVILVSY   199
XP_001477761.1     150   GLFLIEGTSPTPASVFQSAPLCPVILNGMPARVIGMFSLAFLLSVILVSY   199
XP_003085582.1     150   GLFLIEGTSPTPASVFQSAPLCPVILNGMPARVIGMFSLAFLLSVILVSY   199
XP_001474281.1     150   GLFLIEGTSPTPASVFQSAPLCPVILNGMPARVIGMFSLAFLLSVILVSY   199
NP_291094.2        150   GLFLIEGTSPTPASVFQSAPLCPVILNGMPARVIGMFSLAFLLSVILVSY   199
XP_006245550.1     201   GLFLIEGTSPPPASVFQSAPLCPVILNGTPARVIGMFSLAFPLSVILVSY   250


XP_005635867.1     200   SLIYQEGKRAGHFNRSNIKARKTVLIHLVQMGLHVIPTLVFIGLGKMCGV   249
XP_005203082.1     200   SLIYKEGKRAGHFNRSNIKARKTVLIHLVQLGLHVIPTLLFIGLGKMCGV   249
NP_001075215.1     200   CLIYREGKWAGHFNKSNIKARRTVLVHLLQISLHVIPTLIIIGLGKRCGV   249
XP_003084503.1     200   CLIYREGKRAGHFNKSNIKARRTVLVHLLQISLHVIPTLIIIGLGKRCGV   249
XP_001477761.1     200   CLIYREGKRAGHFNKSNIKAQRTVLVHLLQISLHVIPTLIIIGLGKQCGV   249
XP_003085582.1     200   CLIYREGKQAGHFNKSNIKARRTVLVHLLQICLHVIPTLIIIGLGKQCGV   249
XP_001474281.1     200   CLIYREGKRAGHFNKSNIKARRTVLVHLLQISLHVIPTLIIIGLGKQCGV   249
NP_291094.2        200   CLIYREGKQAGHFNKSNIKARRTVLVHLLQISLHVIPTLIIIGLGKRCGV   249
XP_006245550.1     251   CLIYREGKRAGHFNRSNVKARRTVLVHLLQISLHVIPTLIFVGLGKRCGV   300


XP_005635867.1     250   FFFALNMVLFGVFAFAQCLNPLIYGLWNRELQSKLYHWMCCQL-------   292
XP_005203082.1     250   FFFALNLVLFGVFAFAQCFNPLIYGLWNRELQSRLYHWMCCQLWCGHCGV   299
NP_001075215.1     250   FFFALNLALFGIFAFAQCFNHLVYGLHNRDLQSKLYPWLCCRK-------   292
XP_003084503.1     250   FFFALNLALFGIFAFAQCFNPLVYGLHNRDLQSKLYPWLCCRK-------   292
XP_001477761.1     250   FFFALNLALFGIFTFAQCFNPLVYGLHNRDLQSKLYPWLCCQK-------   292
XP_003085582.1     250   FFFALNLALFGIFAFAQCFNPLVYGLHNRDLQSKLYPWLCCRK-------   292
XP_001474281.1     250   FFFALNLALFGIFAFAQCFNPLVYGLHNRDLQSKLYPSLCCQK-------   292
NP_291094.2        250   FFFALNLALFGIFAFAQCFNPLVYGLHNRDLQSKLYPWLCCRK-------   292
XP_006245550.1     301   FFFALNLVLFGIFAFAQCFNPLVYGLHNRDLRSRLYPWLCCQK-------   343


XP_005635867.1           ------
XP_005203082.1     300   TSRVSV   305
NP_001075215.1     293   --KLLP   296
XP_003084503.1     293   --KLLP   296
XP_001477761.1     293   --KLLP   296
XP_003085582.1     293   --KLLP   296
XP_001474281.1     293   --KLLP   296
NP_291094.2        293   --KLLP   296
XP_006245550.1     344   --KLLA   347


Protein Acc. Gene Organism
XP_005635867.1 LOC100686297 C.lupus
XP_005203082.1 LOC787234 B.taurus
NP_001075215.1 Gm7609 M.musculus
XP_003084503.1 Gm15433 M.musculus
XP_001477761.1 LOC100041903 M.musculus
XP_003085582.1 LOC100503923 M.musculus
XP_001474281.1 Gm2666 M.musculus
NP_291094.2 Csprs M.musculus
XP_006245550.1 Csprs R.norvegicus


Support Center