Display Settings:

Format

Send to:

Choose Destination
HomoloGene:84615. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001007034.1       1   MMQEQQPQS---TEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTY   47
XP_001134643.2       1   MMQEQQPQS---TEKRGWWSLRLWSVAGISIALLSACFIVSCVVTYHFTY   47
NP_001029651.1       1   MVREGNAES---C-----FRMRLWCIAVLGLALLSACFIVSCVEK-----   37
NP_064385.1          1   MVQERQSQGKGVC-----WTLRLWSAAVISMLLLSTCFIASCVVTYQFIM   45


NP_001007034.1      48   GETGKRLSELHSYHSSLTCFSEGTKVP--AWGCCPASWKSFGSSCYFISS   95
XP_001134643.2      48   GENGKRLSELHSYHSSLTCFSEGTKVP--AWGCCPASWKSFGSSCYFISS   95
NP_001029651.1      38   -----------------------------IWGCCPGTWKPFGSSCYFISS   58
NP_064385.1         46   DQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLIST   95


NP_001007034.1      96   EEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQG   145
XP_001134643.2      96   EEKVWSKSEQNCVEMGAHFVVFNTEAEQNFIVQQLNEXFSYFLGLSDPQG   145
NP_001029651.1      59   EENFWAKSEQNCIGMGAHLVVINTETEQDFIIQQLNKTFSYFLGLSDPQG   108
NP_064385.1         96   KENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQG   145


NP_001007034.1     146   NNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICE   195
XP_001134643.2     146   NNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICE   195
NP_001029651.1     109   NGNWQWIDQTPYKENVRFWHQNEPNFSAEECASVVFWDGRGWGWNDVFCD   158
NP_064385.1        146   NGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCD   195


NP_001007034.1     196   TRRNSICEMNKIYL   209
XP_001134643.2     196   TRRNSICEMNKIYL   209
NP_001029651.1     159   SKRKSICEMKKIYL   172
NP_064385.1        196   SKHNSICEMKKIYL   209


Protein Acc. Gene Organism
NP_001007034.1 CLEC6A H.sapiens
XP_001134643.2 CLEC6A P.troglodytes
NP_001029651.1 CLEC6A B.taurus
NP_064385.1 Clec4n M.musculus


Support Center