Display Settings:

Format

Send to:

Choose Destination
HomoloGene:79. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000091.1          1   ---MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQV   47
NP_001009095.1       1   ---MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQV   47
XP_001104524.1       1   ---MMCGAPSAVQPATAETQDIADQVRSQLEEKENKKFPVFKAVSFKSQV   47
NP_001032538.1       1   ---MMCGGTSATQPATAETQAIADKVKSQLEEKENKKFPVFKALEFKSQL   47
NP_031819.1          1   ---MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQI   47
NP_036970.1          1   ---MMCGAPSATMPATTETQEIADKVKSQLEEKANQKFDVFKAISFRRQV   47
NP_001185577.1       1   ---MLCGGVSKARPATSETQQIADEVKPQLEEKEGKTFDVFTAVEFKTQL   47
NP_001096599.1       1   -MPLVCGGTSEAKDANEEVQKICDQMKADAEEKAGRKFDVFTAKSFKTQL   49
NP_001070742.1       1   MATKKVGGQSEEKQATPEVQKICDEVKHQAEEKAGKKFTAFTAILFTTQV   50
XP_698401.1          1   -MPLVRGGTSEAKDANEEVQKICDKMKADAEEKAGRKFDVFTAKSFKTQV   49


NP_000091.1         48   VAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTY   97
NP_001009095.1      48   VAGTNYFIKVHVGDEEFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTY   97
XP_001104524.1      48   VAGTNYFIKVHVGDEDFVHLRVFKSLPHENKPLTLSDYQTNKAKHDELSY   97
NP_001032538.1      48   VAGKNYFIKVQVDEDDFVHIRVFESLPHENKPVALTSYQTNKSRHDELTY   97
NP_031819.1         48   VAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSY   97
NP_036970.1         48   VAGTNFFIKVDVGEEKCVHLRVFEPLPHENKPLTLSSYQTDKEKHDELTY   97
NP_001185577.1      48   VAGTNYFIKVHVGNDEFMHLRVFRSLPHEDKPLSLHGYQSSKTKHDELTY   97
NP_001096599.1      50   VAGTNYFVKVHVGDEDYVHLRVYKTLPHAGETLQLTSIQTAKAHHDAIEY   99
NP_001070742.1      51   VAGTNYFIKVNVGGDQFIHLRVHKPLPHAGDKVQLQGVQVSKSCQDPIHY   100
XP_698401.1         50   VAGTNYFVKVHVGDEDYVHLRVYKTLPHAGETLQLTSIQTAKAHHDAIEY   99


NP_000091.1         98   F   98
NP_001009095.1      98   F   98
XP_001104524.1      98   F   98
NP_001032538.1      98   F   98
NP_031819.1         98   F   98
NP_036970.1         98   F   98
NP_001185577.1      98   F   98
NP_001096599.1     100   F   100
NP_001070742.1     101   F   101
XP_698401.1        100   F   100


Protein Acc. Gene Organism
NP_000091.1 CSTB H.sapiens
NP_001009095.1 CSTB P.troglodytes
XP_001104524.1 CSTB M.mulatta
NP_001032538.1 CSTB B.taurus
NP_031819.1 Cstb M.musculus
NP_036970.1 Cstb R.norvegicus
NP_001185577.1 CSTB G.gallus
NP_001096599.1 zgc:56530 D.rerio
NP_001070742.1 zgc:153129 D.rerio
XP_698401.1 si:ch211-161h7.6 D.rerio


Support Center