Display Settings:

Format

Send to:

Choose Destination
HomoloGene:75076. Gene conserved in Tetrapoda Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_060340.2          1   MCARMAGRTTAAPRGPYGPWLCLL--VALALDVVRVDCGQAPLDPVYLPA   48
XP_522023.3          1   MCARMAGRTAAGPRGPYGPWLCLL--VALALDVVRVDCGQAPLDPVYLPA   48
XP_855179.2          1   MCPGM-GRAGAAPRGPRGPWPCLLLALALALDVERVDCDQDPLNTIYLPA   49
NP_001095707.1       1   MCAWMAGRTAAAPRGPRGPWLCLL--VAFALDIVRVDCDQDPLDPVYLPA   48
NP_598565.2          1   ----MTERKAAAPRGPYGAWFCLL--VALALEVVRVSSNHDTLDPIYLPV   44
NP_821140.1          1   ----MTERAAAAPRGPYGAWLCLL--VALALEVVRVGSNQNTLDPIYLPV   44
XP_002942160.1       1   -----------------MEFSVFLLGVLSSAQAI----GSSPSIPI-LPV   28


NP_060340.2         49   ALELLDAPEHFRVQQVG----HYPPANSSLSSRSETFLLLQPWPRAQPLL   94
XP_522023.3         49   ALELLDAPEHFRVQQVG----HYPPANSSLSSRSETFLLLQPWPRAQPLL   94
XP_855179.2         50   TLELLDAPEHFRVQQVG----HYPPANSSLGSRSETFLLLQPWPRVQPLL   95
NP_001095707.1      49   ALGLLDAPEHFRVQQVG----RYPPANSSLGSRSETFLLLQPWPRAQPLL   94
NP_598565.2         45   ALELLDAPEHFRVQQVG----HYPPANSSLASRSETFLLMQPWPRAQPLL   90
NP_821140.1         45   ALELLDAPEHFRVQQVG----HYPPANSSLGSRSETFLLMQPWPRAQPLL   90
XP_002942160.1      29   SIEVKDVPQYFRLQRAAPGEESVPTHGNIAQSHSETFIVTRLGSR-EPHV   77


NP_060340.2         95   RASYPPFATQQVVPPRVTEPHQRPVPWDVRAVSVEAAVTPAEPYARVLFH   144
XP_522023.3         95   RASYPPFATQQVVPPRVTEPHQRPVPWDVRAVSVEAAVTPAEPHARVLFH   144
XP_855179.2         96   RASYPPFATQQVVPPRVTEPHQRPVPWDVRAVSVEAAVTPAEPHARVLFH   145
NP_001095707.1      95   RASYPPFATQQVVPPRVTEPHQRPVPWDVRAVSVEAAVTPAEPHARVLFH   144
NP_598565.2         91   RASYPPFATQQVVPPRVTEPHRRPVPWDVRAVSVEAAVTPAEPYARVLFH   140
NP_821140.1         91   RASYPPFATQQVVPPRVTEPHRRPVPWDVRAVSVEAAVTPAEPYARVLFH   140
XP_002942160.1      78   RASYQHLQVQENVPWNKLGARIRGVQGEV----VGDEVSPSDPVTRILFH   123


NP_060340.2        145   LKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPSLGACVVELELPSHW   194
XP_522023.3        145   LKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPSLGACVVELELPSHW   194
XP_855179.2        146   LKGQDWPPGPGSLPCAWLHATHPAGTAHQACHFQPSLGACVVELEFPSHW   195
NP_001095707.1     145   LRGQDWPPGPGSLPCARLHATHPAGTAHRACRFQPSLGACVVELEFPSHW   194
NP_598565.2        141   LKGQDWPPGPGSLPCARLHATHPAGTAHRACRFQPSLGACVVELQFPSHW   190
NP_821140.1        141   LKGQDWPPGPGSLPCARLHATHPAGTAHQACRFQPSLGACVVELQFPSQW   190
XP_002942160.1     124   RSGVDGQARGAQNTCVNVRGTYDGVNVEGSCRIQLPLDVCVVELLFSPSW   173


NP_060340.2        195   FSQAS-TTRAELAYTLEPAAEGPGGCGSGEENDPGEQALPVGGVELRPAD   243
XP_522023.3        195   FSQAS-TTRAELAYTLEPAAEGPGGCGSGEENDPGEQALPVGGVELRPAD   243
XP_855179.2        196   FSQGS-TTRAELAYTLEPAAEGPGGCGPSQEEDPREQALPVGGVELRPAD   244
NP_001095707.1     195   FSQGS-ATRAELAYTLEPAAEGPGGCGPGGEEDPGEQALPVGSVELRPAD   243
NP_598565.2        191   FSQSA-TTRAELAYTLEPAGEGPGGCGLGTEEEPREQALPVGGVELHPED   239
NP_821140.1        191   FSQSA-TTRAELAYTLEPAGEGPGGCGPGTEEEPKEQALPVGSVELHPED   239
XP_002942160.1     174   FSLSTLPLNVTLTYMVSDDCKSMG-----------EVSEVAGSVRVVSVG   212


NP_060340.2        244   PPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHNFTASLLTLRIKVK   293
XP_522023.3        244   PPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHNFTASLLTLRIKVK   293
XP_855179.2        245   PPQYQEVPLDEAVTLRVPDVPVRPGQLFSATLLLRHNFTASILTLRIKVK   294
NP_001095707.1     244   PPQHQEVPLDEAVTLRVPDVPVRPGQLFSATLLLRHNFTAGVLTLRIKVK   293
NP_598565.2        240   PPQYQEVPLDEAVTLRAPDVPMRPGQLFTATLLLRHNFTASLLTLRIKVK   289
NP_821140.1        240   PPQHQEVPLDEVVTLRAPDVPVRPGQLFTATLLLRHNFTASLLTLRIKVK   289
XP_002942160.1     213   TPRIQQVSVGDSVTISLPDKTLLPGEVFTASINLRQNWTQPSFSLRVRCR   262


NP_060340.2        294   KGLHVTAARPAQPTLWTAKLDRFKGSRHHTTLITCHRAGLTEPDSSSPLE   343
XP_522023.3        294   KGLHVTAARPAQPTLWTAKLDRFKGSKHHTTLITCHRAGLTEPDSSSPLE   343
XP_855179.2        295   KGLHVTAARPVQPSLWTAKLDRFKGSKHHTTLIICHRAGNTGLDSSSPPE   344
NP_001095707.1     294   KGLHVMAARLAQPTLWTTKLERFKGSKHHTTLITCHRVGPVEPN-SSPLE   342
NP_598565.2        290   KGLQVIAARPAQPTLWTAKLDRFKGSKHHTSLITCHRAGPAGPD-SSPLE   338
NP_821140.1        290   KGLQVTAARPAQPTFWTAKLDRFKGSKHHTSLITCHRTGPAGPD-SRPLE   338
XP_002942160.1     263   TGLELLFARSAAPNTWAIKTEMQKGAKHHTVIGHVTHRGASE---RRP--   307


NP_060340.2        344   LSEFLWVDFVVENSTGGGVAVTRPVTWQLEYPGQ---APEAEKDKMVWEI   390
XP_522023.3        344   LSEFLWVDFVVENSTGGGVAVTRPVTWQLEYPGQ---APEAEKDKMVWEI   390
XP_855179.2        345   LSEFLWVDFLVENGTSGGVAVTRPVTWQLEYAGQ---APEAEKDKMVWEI   391
NP_001095707.1     343   LSEFLWVDFLVENGTSGGVAVTRPVTWQLEYPGQ---APEAEKDKMVWEI   389
NP_598565.2        339   LSEFLWVDFAVENSTGGGVAVTRPVTWQLEYPGQ---APEAEKDKMVWEI   385
NP_821140.1        339   LPEFLWVDFAVENSTGGGVAVTRPVTWQLEYPGQ---APEAEKDKMVWEI   385
XP_002942160.1     308   LPAVALLDFLVSNISVGS-AVSRRITFQLDIPGSSVVAAAAAGVRGSAEV   356


NP_060340.2        391   LVSERDIRALIPLAKAEELVNTAPLTGVPQHVPVRLVTVDGGGALVEVTE   440
XP_522023.3        391   LVSERDIRALIPLAKAEELVNTAPLTGVPQHVPVRLVTVDGGGALVEVTE   440
XP_855179.2        392   LVSERDVRALVPLAKAEELVNTAPLTGEPRHVPIRLVTVDNGGALVEVTE   441
NP_001095707.1     390   LVSEQDIRALVPLAKAEELVNTAPLTGVPRRIPVRLVTVDSGGALVEVTE   439
NP_598565.2        386   LVSERDIRALIPLAKAEELVNTAPLTGVPQRIPVRLVTVDSGGALEEVTE   435
NP_821140.1        386   LFSERDIRALIPLAKAEELVNTAPLTGVPQRIPVRLVTVDSGGALEEVTE   435
XP_002942160.1     357   LVSDRDLRAILPLVKSHEILNTAPLTGISQKIPVRVLAIEAGGTVLDVTK   406


NP_060340.2        441   HVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWRRLRASLRLT   490
XP_522023.3        441   HVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWRRLRASLRLT   490
XP_855179.2        442   HIGCESTNTQVLQVSETCDAVFVSGKESRGAQGVQVDFWWRRLRASLQMT   491
NP_001095707.1     440   HIGCESANTQVLQVSEACDAVFVSGKESRGALGVRVDFWWRRLRASLRMT   489
NP_598565.2        436   HIGCESANTQVLQVSEACDAVFVAGQESRGAKGVRVDFWWRRLRASLKLT   485
NP_821140.1        436   HIGCESANTQVLQVSEACDAVFVAGQESRGAKGVRVDFWWRRLRASLKLT   485
XP_002942160.1     407   QAGCETPNAQIVQVSDGCDFLFVGGKETQGALGVKVEFWLERLRASLSLS   456


NP_060340.2        491   VWAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASD-EAERRARG   539
XP_522023.3        491   VWAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASD-EAERRARG   539
XP_855179.2        492   VWAPLLPLRIELTDTTLEQVRGWRVPGPTEGMPEPEAAA-E-EAERRPRS   539
NP_001095707.1     490   VWAPLLPLRIEVTDTTLEQVRGWRVPGPAEGAREPEAAGVE-EAERRARG   538
NP_598565.2        486   VWAPLLPLRIELTDTTLEQIRGWRVPGSAEGQLEPETAA-E-EVERRSRG   533
NP_821140.1        486   VWAPLLPLRIELTDTTLEQIRGWRVPGPAEGQLEPEAAA-E-EVERRSRG   533
XP_002942160.1     457   LWVPLLPLRIEVSDTNLQRLQG---SGLVSTSLEDDGGERKTSSDRRSQS   503


NP_060340.2        540   CHLQYQRAGVRFLAPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAPHARVL   589
XP_522023.3        540   CHLQYQRAGVRFLAPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAPHARVL   589
XP_855179.2        540   CRLQYQRAGVRFLVPFAAHPLDGGRRLTHLLGPDWLLDVTHLVAPHARVQ   589
NP_001095707.1     539   CRLQYQRAGVRFLVPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAPHARVQ   588
NP_598565.2        534   CRLQYQRAGVRFLVPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAAHAHVQ   583
NP_821140.1        534   CRLQYQRAGVRFLVPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAAHAHVQ   583
XP_002942160.1     504   CRPLYQRARVRFLAYFVAHSLDGSRQLTYLLGTDWLLDVSPLIRSQAVIR   553


NP_060340.2        590   DSRVASL-EGGRVVVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVL   638
XP_522023.3        590   DSRVASL-EGGRVLVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVL   638
XP_855179.2        590   DPRVASL-EGGRILVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVL   638
NP_001095707.1     589   DPRVASL-EGGRVLVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVL   637
NP_598565.2        584   DPRIASL-EGGRILVGREPGVTSIEVRSPLSDAILGEQALAVTDDKVSVL   632
NP_821140.1        584   DPRIATL-EGGRILVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVL   632
XP_002942160.1     554   DPHIARLEEEGSILIGQEPGVTSVEVRSPVSHSILGEQTVLVSLETVSVL   603


NP_060340.2        639   ELRVQPVMGISLTLSRG-TAHPGEVTATCWAQSALPAPKQEVALSLWLSF   687
XP_522023.3        639   ELRVQPVMGISLTLSRG-TAHPGEVTATCWAQSALPAPKQEVALSLWLSF   687
XP_855179.2        639   ELQVQPVMGISLALSRG-TAHPGEVTATCWAQSAFPAPKQEVALSLWLSF   687
NP_001095707.1     638   ELRVQPVMGISLALSRG-TAHPGEVTATCWAQSALPAPKQEVALSLWLSF   686
NP_598565.2        633   DLRVQPVMGISLSLSRG-MSHPGEVTATCWAQSALPAPKQEVALSLWLSF   681
NP_821140.1        633   DLRVQPVMGISLSLSRG-VSHPGEVTATCWAQSALPAPKQEVALSLWLSF   681
XP_002942160.1     604   ELRSNLMWGVNLSVSTAEIKHPGVFSVLCQSNNLEMIPKQESALSLWFLF   653


NP_060340.2        688   SDHTVAPAELYDRRDLGLSVSAEEPGAILP----AEEQGAQLGVVVSGAG   733
XP_522023.3        688   SDHTVAPAELYDRRDLGLSVSAEEPGAILP----AEEQGAQLGVVVSGAG   733
XP_855179.2        688   SDHTLVPAELYNQHDLGLSVSAEEPGAILP----AKDQGAQLGVVVSGAG   733
NP_001095707.1     687   SDHTLAPAELYDHHDLGLSVSAEEPGAVLP----AEEQGAQLRVVVSGAG   732
NP_598565.2        682   SDHTLAPAELYDRNDLGLSVSAEEPSAVLP----AEEQGAQLGVVVSGVG   727
NP_821140.1        682   SDHTLAPAELYDRNDLGLSVSAEEPSAVVP----AEEQRAQLGVVVSGVG   727
XP_002942160.1     654   SDFSTAPVNIYDPLDLTVMVVSSDPSVLSVRRPLMNGNSWSLPVLVFENA   703


NP_060340.2        734   AEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPASTPAPALPSSPAW   783
XP_522023.3        734   AEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPASTPAPALPSSPAW   783
XP_855179.2        734   AEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPAPTPPPALPSSPAR   783
NP_001095707.1     733   TEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPAPTSAPALPSSPAR   782
NP_598565.2        728   AEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPLPTPVPALPSSPVR   777
NP_821140.1        728   AKGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPLPTPAPALPSSPAR   777
XP_002942160.1     704   GQLPLLRFSILLPERCQEEESSGVLTAGYVRVTFPSNRTEGGEHQSSDII   753


NP_060340.2        784   -SPPATEATMGGKRQVAGSVGGNT--GVRGKFERAEEEARKEETEAREEE   830
XP_522023.3        784   -SPPATEATMGGEQQVAGSVGGNI--GVRGKFERAEEEARKEETEAREEE   830
XP_855179.2        784   -GPPATEASVGGKQWEAGGVGGSG--VVKGKFERA-------EAEAREEE   823
NP_001095707.1     783   SSSPAPGASVGGGRWAAGSMGGSG--DVRGKFEQTEEEARKEEAEAREEE   830
NP_598565.2        778   -TSPFTEATVEGKRQIAGDMGGHV--GIRGKFERAEEEAGKEENEAKEEE   824
NP_821140.1        778   -TPPFTEASVEGKRQVAGDMGSHVGPGIRGKFERAEEEAGKEENEAKEEE   826
XP_002942160.1     754   -QSDSDLITKDGEMISSANN------IIPGTNDII---IRSDDIRHEDDD   793


NP_060340.2        831   EEE-EEEMVPAPQHVTELELGMYALLGVFCVAIFIFLVNGVVFVLRYQRK   879
XP_522023.3        831   EEE-EEEMVPAPQHVTELELGMYALLGIFCVAIFIFLVNGVVFVLRYQRK   879
XP_855179.2        824   EEEEEEEMVPAPQRVTDLELGMYALLGIFCLAILIFLVNGVVFVLRYQRK   873
NP_001095707.1     831   EEEGEEEMVPAPQRVTDLELGMYALLGIFCLAILIFLVNGVVFVLRYQRK   880
NP_598565.2        825   ED--EEEMVPAPQRVTDLELGMYALLGIFCLAILIFLVNGVVFVLRYQRK   872
NP_821140.1        827   ED--EEEMVPAPQRVTDLELGMYALLGIFCLAFLIFLVNGVVFVLRYQRK   874
XP_002942160.1     794   SISGADDIITTRWGIPGLEEGLYGLLAIFSLLTLLFLLSCVAFIMRHRKK   843


NP_060340.2        880   EPPDSATDPTSPQPHNWVWLGTDQEELSRQL-----------DR-QSPGP   917
XP_522023.3        880   EPPDSATDPTSPQPHNWVWLGTDQEELSRQL-----------DR-QSPGP   917
XP_855179.2        874   EPPDGATDPASPQPHNWVWLGTDQEELSRQL-----------DR-QSPGL   911
NP_001095707.1     881   EPPDGATDPASPQPHNWVWLGTDQEELSRQL-----------DR-QSPGP   918
NP_598565.2        873   EPPDSATDPASPQPHNWVWLGTNQEELSRQL-----------DRCSSSGP   911
NP_821140.1        875   EPPDSVTDPASPQPHNWVWLGTNQEELSRQL-----------DRCSSSSP   913
XP_002942160.1     844   SPPEG---PGNPEAPNWVWLEGQEVDSQRNQGGGNVREEEEDENEQWEGR   890


NP_060340.2        918   PKGEGS-----CPCESGGGGEAPTLAPG-----PPGGTTSSSSTLARKEA   957
XP_522023.3        918   PKGEGS-----CPCESGGGGEAPTLGPG-----PPGGTTSSSSTLARKEA   957
XP_855179.2        912   PQGEGG-----CPCESGGGGEALTVAQA-----PGGGTSSSSSTLARKEA   951
NP_001095707.1     919   PKGEGG-----CPCESGGGGEALTLAQAQAQAPPTGATTSSSGTLARKEA   963
NP_598565.2        912   PKGEGG-----CPCESGAGGDASTVAPS-----ASESPAGSSSTLARKEA   951
NP_821140.1        914   PKGEGG-----CPCESGAGGDTSTVAPS-----ASESPAGSTSTLARKEA   953
XP_002942160.1     891   ERGPQSLTSTFHPVRSSHDPETSICPPS------DPCSFSTPTSLSRALL   934


NP_060340.2        958   GGRRKRVEFVTFAPAPPAQ-SPEEPVGAPAVQSILVAGEEDIRWVCEDMG   1006
XP_522023.3        958   GGRRKRVEFVTFAPAPPAQ-PPEEPVGAPAVQSILVAGEEDIRWVCEDMG   1006
XP_855179.2        952   GGRRKRVEFVTFAPAPLAE-LSQESVGAPAVQSILVAGEEDIRWVCEDMG   1000
NP_001095707.1     964   GGRRKRVEFVTFAPAPPAQ-LPEEPVGAPAVQSILVAGEEDIRWVFEDMG   1012
NP_598565.2        952   GGRRKRVEFVTFAPAPPTQ-PPEEPVGAPAVQSILVAGEEDIRWVCEDMG   1000
NP_821140.1        954   GGRRKRVEFVTFAPAPPAQEAPEEPVGAPAVQSILVAGEEDIRWVCEDMG   1003
XP_002942160.1     935   EAKRPEVMSFQTATTNGSEKRGDRVPDDPSVRSILVASEEDIMWVCKDMG   984


NP_060340.2       1007   LKDPEELRNYMERIRGSS---------------------------   1024
XP_522023.3       1007   LKDPEELRNYMERIRGSS---------------------------   1024
XP_855179.2       1001   LKDPEELRSYMERIRGSS---------------------------   1018
NP_001095707.1    1013   LKDPEELRSYMERIRGSS---------------------------   1030
NP_598565.2       1001   LKDPEELRNYMERIRGSS---------------------------   1018
NP_821140.1       1004   LKDPEELRNYMERIRGSS---------------------------   1021
XP_002942160.1     985   IREPQEIRSYMEKIRGETPPQSDRRREGPWGRGIEVTGASVRRLT   1029


Protein Acc. Gene Organism
NP_060340.2 TMEM132A H.sapiens
XP_522023.3 TMEM132A P.troglodytes
XP_855179.2 TMEM132A C.lupus
NP_001095707.1 TMEM132A B.taurus
NP_598565.2 Tmem132a M.musculus
NP_821140.1 Tmem132a R.norvegicus
XP_002942160.1 tmem132a X.tropicalis


Support Center