Display Settings:

Format

Send to:

Choose Destination
HomoloGene:74981. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_776558.1              --------------------------------------------------
NP_035794.1              --------------------------------------------------
NP_620250.1              --------------------------------------------------
XP_004946719.1       1   MFRFTGNISLTPSFPLLKAGYFVLLPNDLLLKLLARSMCPQQQALHPGKG   50
NP_572306.1              --------------------------------------------------
XP_312337.4              --------------------------------------------------
NP_001031824.1           --------------------------------------------------
NP_849292.1              --------------------------------------------------
XP_004910600.1       1   -------------------MAALNKKRKSLDEHIDASCCPSVNAEPPLRA   31


NP_776558.1              --------------------------------------------------
NP_035794.1              --------------------------------------------------
NP_620250.1              --------------------------------------------------
XP_004946719.1      51   WNHLCSQSSHKIRRSIFSAATFLTAAPISADHATVWSSRFTATPDPSAPS   100
NP_572306.1              --------------------------------------------------
XP_312337.4              --------------------------------------------------
NP_001031824.1           --------------------------------------------------
NP_849292.1              --------------------------------------------------
XP_004910600.1      32   WPKAN---------------------------------------------   36


NP_776558.1          1   --------------------------------MQIFVKTLTGKTITLEVE   18
NP_035794.1          1   --------------------------------MQIFVKTLTGKTITLEVE   18
NP_620250.1          1   --------------------------------MQIFVKTLTGKTITLEVE   18
XP_004946719.1     101   EILGLLRVSALCRRYQGPLCSWKRDWRGREVNMQIFVKTLTGKTITLEVE   150
NP_572306.1          1   --------------------------------MQIFVKTLTGKTITLEVE   18
XP_312337.4          1   --------------------------------MQIFVKTLTGKTITLEVE   18
NP_001031824.1       1   --------------------------------MQIFVKTLTGKTITLEVE   18
NP_849292.1          1   --------------------------------MQIFVKTLTGKTITLEVE   18
XP_004910600.1      37   --------------------------------MQIFVKTLTGKTITLEVE   54


NP_776558.1         19   PSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH   68
NP_035794.1         19   PSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH   68
NP_620250.1         19   PSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH   68
XP_004946719.1     151   PSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH   200
NP_572306.1         19   PSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIY   68
XP_312337.4         19   PSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH   68
NP_001031824.1      19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH   68
NP_849292.1         19   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH   68
XP_004910600.1      55   PSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH   104


NP_776558.1         69   LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR   118
NP_035794.1         69   LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR   118
NP_620250.1         69   LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR   118
XP_004946719.1     201   LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR   250
NP_572306.1         69   LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQR   118
XP_312337.4         69   LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR   118
NP_001031824.1      69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR   118
NP_849292.1         69   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR   118
XP_004910600.1     105   LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR   154


NP_776558.1        119   LIFAGKQLEDGRTLFDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   168
NP_035794.1        119   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   168
NP_620250.1        119   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   168
XP_004946719.1     251   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   300
NP_572306.1        119   LIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLE   168
XP_312337.4        119   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   168
NP_001031824.1     119   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   168
NP_849292.1        119   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   168
XP_004910600.1     155   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE   204


NP_776558.1        169   VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST   218
NP_035794.1        169   VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST   218
NP_620250.1        169   VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST   218
XP_004946719.1     301   VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST   350
NP_572306.1        169   VEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST   218
XP_312337.4        169   VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST   218
NP_001031824.1     169   VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST   218
NP_849292.1        169   VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST   218
XP_004910600.1     205   VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST   254


NP_776558.1        219   LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ   268
NP_035794.1        219   LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ   268
NP_620250.1        219   LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ   268
XP_004946719.1     351   LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ   400
NP_572306.1        219   LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHDKDGIPPDH   268
XP_312337.4        219   LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ   268
NP_001031824.1     219   LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ   268
NP_849292.1        219   LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ   268
XP_004910600.1     255   LHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ   304


NP_776558.1        269   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG-C   305
NP_035794.1        269   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG-Y   305
NP_620250.1        269   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG-Y   305
XP_004946719.1     401   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG-Y   437
NP_572306.1        269   QRLIFAGKQLEDGRTLSDYNIQKESTLHSHFK-----W   301
XP_312337.4        269   QRLIFAGKQLEDGRTLSDYNIQKESPLHLVLRPRGV-N   305
NP_001031824.1     269   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGSF   306
NP_849292.1        269   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG-F   305
XP_004910600.1     305   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG-V   341


Protein Acc. Gene Organism
NP_776558.1 UBB B.taurus
NP_035794.1 Ubb M.musculus
NP_620250.1 Ubb R.norvegicus
XP_004946719.1 LOC101747587 G.gallus
NP_572306.1 CG11700 D.melanogaster
XP_312337.4 AgaP_AGAP002599 A.gambiae
NP_001031824.1 UBQ3 A.thaliana
NP_849292.1 UBQ14 A.thaliana
XP_004910600.1 ubc X.tropicalis


Support Center