Display Settings:

Format

Send to:

Choose Destination
HomoloGene:74538. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_005054.3          1   MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPD-   49
XP_001168563.1       1   MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETTPLYLEDNIRPD-   49
XP_001107910.2       1   MPAHLLQEDISSSYTTTTTITAPPSRVLQNGRDKLETTPLYLEEDVRPD-   49
XP_543968.2          1   MPAHLLQEEISSSYTTTTTITAPPSRILQNGGGKLEKPSLYLEEDIRPE-   49
NP_776384.3          1   MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPE-   49
NP_033153.2          1   MPAHMLQE-ISSSYTTTTTITAPPSG---NEREKVKTVPLHLEEDIRPE-   45
NP_631931.2          1   MPAHMLQE-ISSSYTTTTTITEPPSGNLQNGREKMKKVPLYLEEDIRPE-   48
NP_990221.1          1   MPAHLLQEEEFSSASSTTTVTSRVTK----NGNVIMEKDLLNHDDVAAER   46
NP_001018541.1       1   ------------------------------------------MADVTTT-   7
NP_650201.1          1   --------------------MAPYSRIYHQDKSSRETGVLFEDDAQTVD-   29
NP_001027500.1       1   -------------------MTFRGSQ----TVSTVMESPSIIQDEIGADR   27


NP_005054.3         50   -IKDDIYDPTYKDKEG-PSPKVEYVWRNIILMSLLHLGALYGI-TLIPTC   96
XP_001168563.1      50   -IKDDIYDPTYKDKEG-PSPKVEYVWRNIILMSLLHLGALYGI-TLIPTC   96
XP_001107910.2      50   -IKDDIYDPTYKDKEG-PSPKVEYVWRNIILMSLLHLGALYGI-TLIPTC   96
XP_543968.2         50   -IKDDIYDPTYKDPEGRPKPKVEYVWRNIILMSLLHVGALYGI-TLIPTC   97
NP_776384.3         50   -MRDDIYDPTYQDKEG-PKPKLEYVWRNIILMSLLHLGALYGI-TLIPTC   96
NP_033153.2         46   -MKEDIHDPTYQDEEG-PPPKLEYVWRNIILMVLLHLGGLYGI-ILVPSC   92
NP_631931.2         49   -MREDIHDPSYQDEEG-PPPKLEYVWRNIILMALLHVGALYGI-TLIPSS   95
NP_990221.1         47   GMVDDLFDETYREKEG-PKPPLRYVWRNIILMSLLHLGAIIGL-TLIPSA   94
NP_001018541.1       8   --TEDVFDDSYVEKPG-PSPPVQIVWRNVILMTLLHLGALYGM-TILPFV   53
NP_650201.1         30   ---GDLTTDRFQLKRA-EKRRLPLVWRNIILFALVHLAALYGLHSIFTRA   75
NP_001027500.1      28   VMTDDIFDTTYIKKVD-FKPPIKLVWRNVILMALLHFGAFYGL-FMIPAA   75


NP_005054.3         97   KFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLIIANTMAF   146
XP_001168563.1      97   KFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLIIANTMAF   146
XP_001107910.2      97   KLYTCLWGLFYYVVSALGITAGAHRLWSHRSYKARLPLRLFLIIANTMAF   146
XP_543968.2         98   KTYTWLWVFSYYLISAVGITAGAHRLWSHRTYKARLPLRLFLIIANTMAF   147
NP_776384.3         97   KIYTYIWVLFYYLMGALGITAGAHRLWSHRTYKARLPLRVFLIIGNTMAF   146
NP_033153.2         93   KLYTCLFGIFYYMTSALGITAGAHRLWSHRTYKARLPLRIFLIIANTMAF   142
NP_631931.2         96   KVYTLLWGIFYYLISALGITAGAHRLWSHRTYKARLPLRIFLIIANTMAF   145
NP_990221.1         95   KIQTLAWAILCFVLSALGITAGSHRLWSHRSYKATLPLRIFLTIANSMAF   144
NP_001018541.1      54   SSLTLIWTGVCFMVSALGITAGAHRLWSHRSYRASLPLRIFLAVANSMAF   103
NP_650201.1         76   KLATTLFAAGLYIIGMLGVTAGAHRLWAHRTYKAKWPLRLLLVIFNTIAF   125
NP_001027500.1      76   KPITLAWAILCFMLSALGVTAGAHRLWSHRSYKAKLPLRIFLAVVNSMAF   125


NP_005054.3        147   QNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK   196
XP_001168563.1     147   QNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK   196
XP_001107910.2     147   QNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK   196
XP_543968.2        148   QNDVYEWARDHRAHHKFSETDADPHNSRRGFFFSHVGWLLVRKHPAVKEK   197
NP_776384.3        147   QNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSHVGWLLVRKHPAVKEK   196
NP_033153.2        143   QNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK   192
NP_631931.2        146   QNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK   195
NP_990221.1        145   QNDIYEWARDHRVHHKFSETHADPHNAMRGYFFSHMAWLLVRKHPDVIEK   194
NP_001018541.1     104   QNDIYEWARDHRVHHKFSETDADPHNARRGFFFAHIGWLLVRKHPEVIDK   153
NP_650201.1        126   QDAVYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPDIKEK   175
NP_001027500.1     126   QNDIYEWARDHRVHHKYSETDADPHNAVRGFFFSHIGWLLMRKHPDVIEK   175


NP_005054.3        197   GSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSV   246
XP_001168563.1     197   GSTLDLSDLEAEKLVMFQRRYYKTGLLLMCFILPTLVPWYFWGETFQNSV   246
XP_001107910.2     197   GATLDLSDLEAEKLVMFQRRYYKPGLLLMCFILPTLVPWCFWGETFQHSV   246
XP_543968.2        198   GGLLDLSDLKAEKLVMFQRRYYKPGILLMCFILPTFVPWYFWGETFLHSV   247
NP_776384.3        197   GSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDETFQNSL   246
NP_033153.2        193   GGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFVNSL   242
NP_631931.2        196   GGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFLHSL   245
NP_990221.1        195   GQKLDLSDLKADKVVMFQRRYYKPSVVLLCFTLPTLVPWYFWDESIIISF   244
NP_001018541.1     154   GRKLTFEDLKADSVVMFQRRHYKLSVVVMCFLIPTLVPWFFWEESLWTAY   203
NP_650201.1        176   GRGLDLSDLRADPILMFQRKHYYILMPLACFVLPTVIPMVYWNETLASSW   225
NP_001027500.1     176   GKKLDLSDLKADKVVMFQRRNYKLSILVMCFILPTVIPWYFWDESFSVAF   225


NP_005054.3        247   FVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEG   296
XP_001168563.1     247   FVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEG   296
XP_001107910.2     247   FVATFLRYAIVLNVTWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEG   296
XP_543968.2        248   CVATLLRYAIVLNATWLVNSAAHLYGYRPYDKNISPRENILVSLGAAGEG   297
NP_776384.3        247   FFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEG   296
NP_033153.2        243   FVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEG   292
NP_631931.2        246   FVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEG   295
NP_990221.1        245   FIPAILRYTLGLNATWLVNSAAHMFGNRPYDQNINPRENPLVSVGALGEG   294
NP_001018541.1     204   LVPCLLRYAVVLNATWLVNSAAHMWGMRPYDHNINPRENKFVAFSAIGEG   253
NP_650201.1        226   FVATMFRWCFQLNMTWLVNSAAHKFGNRPYDKTMNPTQNAFVSAFTFGEG   275
NP_001027500.1     226   YVPCLLRYALVLNATWLVNSAAHMYGNRPYDQTINPRENPLVAIGAIGEG   275


NP_005054.3        297   FHNYHHSFPYDYSASEYR-WHINFTTFFIDCMAA------LGLAYDRKKV   339
XP_001168563.1     297   FHNYHHSFPYDYSASEYR-WHINFTTFFIDCMAA------LGLAYDRKKV   339
XP_001107910.2     297   FHNYHHSFPYDYSASEYR-WHINFTTFFIDCMAHCPPFHFVAIALLSLIA   345
XP_543968.2        298   FHNYHHSFPYDYSASEYR-WHINFTTFFIDCMAA------LGLAYDRKKV   340
NP_776384.3        297   FHNYHHTFPYDYSASEYR-WHINFTTFFIDCMAA------IGLAYDRKKV   339
NP_033153.2        293   FHNYHHTFPFDYSASEYR-WHINFTTFFIDCMAA------LGLAYDRKKV   335
NP_631931.2        296   FHNYHHAFPYDYSASEYR-WHINFTTFFIDCMAA------LGLAYDRKKV   338
NP_990221.1        295   FHNYHHTFPYDYSTSEFG-WRFNLTTAFIDLMCL------LGLASDRKKV   337
NP_001018541.1     254   FHNYHHTFPHDYATSEFG-SRLNVTKAFIDLMCF------LGLANDCRRV   296
NP_650201.1        276   WHNYHHAFPWDYKTAEWGCYSLNITTAFIDLFAK------IGWAYDLKTV   319
NP_001027500.1     276   FHNYHHTFPFDYSTSEFG-LKFNITTGFIDLMCL------LGLANDCKRV   318


NP_005054.3        340   SKAAILARIKRTGDGNY----------------------KSG   359
XP_001168563.1     340   SKAAILARIKRTGDGNY----------------------KSG   359
XP_001107910.2     346   SQASSWSVFVQCPASKA-------------------------   362
XP_543968.2        341   SKAAILARIKRTGDGSY----------------------KSG   360
NP_776384.3        340   SKAAILARIKRTGEESY----------------------KSG   359
NP_033153.2        336   SKATVLARIKRTGDGSH----------------------KSS   355
NP_631931.2        339   SKAAVLARIKRTGDGSH----------------------KSS   358
NP_990221.1        338   SKEVILARKMRTGDGSH----------------------KSG   357
NP_001018541.1     297   THETILARVQRTGDGSH----------------------KSG   316
NP_650201.1        320   APDVIQRRVLRTGDGSHELWGWGDKDLTAEDARNVLLVDKSR   361
NP_001027500.1     319   SKETIMARKKRTGDGSH----------------------RSG   338


Protein Acc. Gene Organism
NP_005054.3 SCD H.sapiens
XP_001168563.1 SCD P.troglodytes
XP_001107910.2 SCD M.mulatta
XP_543968.2 SCD C.lupus
NP_776384.3 SCD B.taurus
NP_033153.2 Scd1 M.musculus
NP_631931.2 Scd1 R.norvegicus
NP_990221.1 SCD G.gallus
NP_001018541.1 scdb D.rerio
NP_650201.1 desat2 D.melanogaster
NP_001027500.1 scd X.tropicalis


Support Center