Display Settings:

Format

Send to:

Choose Destination
HomoloGene:73898. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000765.2          1   MDSISTAILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQD   50
XP_001139965.3           --------------------------------------------------
NP_001035330.1       1   MDSISTAILLLLLALVCLLLTLSSRDKXKLPPGPRPLPLLGNLLLLRSQN   50
XP_005616608.1       1   MDGVSTAILLGLLALAFLFLILNSRGKSQLPPGPRPLPFLGNLLQLRSQD   50
NP_031843.2          1   MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQLRSQD   50
NP_062176.1          1   MDGVSTAILLLLLAVISLSLTFTSWGKGQLPPGPKPLPILGNLLQLRSQD   50


NP_000765.2         51   MLTSLTKLSKEYGSMYTVHLGPRRVVVLSGYQAVKEALVDQGEEFSGRGD   100
XP_001139965.3           --------------------------------------------------
NP_001035330.1      51   MLTSLTQLSKEYGSVYTVHLGPRRVVVLSGYQAVKEALVDQGEEFSGRGD   100
XP_005616608.1      51   MLTSLTKLSKEYGSVYTVHLGPRRVVVLSGYQAVKEALVDQGEDFSGRGD   100
NP_031843.2         51   LLTSLTKLSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRGA   100
NP_062176.1         51   LLTSLTKLSKDYGSVFTVYLGPRRVIVLSGYQTVKEALVDKGEEFSGRGS   100


NP_000765.2        101   YPAFFNFTKGNGIAFSSGDRWKVLRQFSIQILRNFGMGKRSIEERILEEG   150
XP_001139965.3       1   ------------------------MTLPVQVHQMQGGGDRTLEKRILEGG   26
NP_001035330.1     101   YPVFFNFTKGNGIAFSNGDRWKVLRRFSIQILRNFGMGKRSIEERILEEG   150
XP_005616608.1     101   YPVFFNFTKGNGIAFSNGDRWKVLRRFSVQILRNFGMGKRSIEERILEEG   150
NP_031843.2        101   YPVFFNFTRGNGIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEG   150
NP_062176.1        101   YPIFFNFTKGNGIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEG   150


NP_000765.2        151   SFLLAELRKTEGEPFDPTFVLSRSVSNIICSVLFGSRFDYDDERLLTIIR   200
XP_001139965.3      27   QLLLAELRKPSGEPFDPTFVLSRSVSNIICSVLFGSRFDYDDERLLTIIR   76
NP_001035330.1     151   SFLLAELRKTEGEPFDPTFVLSRSVSNIICSVLFGSRFDYDDERLLTVIR   200
XP_005616608.1     151   SFLLAELRKTEGKPFDPTFVLSRSVSNIICSVIFGSRFDYDDERLLTIIR   200
NP_031843.2        151   SFLLEVLRKMEGKPFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIH   200
NP_062176.1        151   SFLLDVLRKTEGKPFDPVFILSRSVSNIICSVIFGSRFDYDDERLLTIIH   200


NP_000765.2        201   LINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVH   250
XP_001139965.3      77   LINDNFQIMSSPWGELYNIFPSLLNWVPGPHQRIFQNFKCLRDLIAHSVH   126
NP_001035330.1     201   LINDNFQIMSSPWGELYNIFPSLLDWVPGPHQRIFQNFKRLRDLIAHXVH   250
XP_005616608.1     201   LINDNFQIMSGPWGELYNIFPSLLDWIPGPHRRLFQNFGCMKDLIARSVR   250
NP_031843.2        201   FINDNFKIMSSPWGEMYNIFPSVLDWIPGPHKRLFRNFGGMKDLIARSVR   250
NP_062176.1        201   FINDNFQIMSSPWGEMYNIFPSLLDWVPGPHRRVFRNFGGMKDLIARSVR   250


NP_000765.2        251   DHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLMTTHNLLFGGT   300
XP_001139965.3     127   DHQASLDPRSPRDFIDCFLTKMAEKKEDPLSHFHMDTLLMTTHNLLFGGT   176
NP_001035330.1     251   DQQASLDPRSPRDFIDCFLTKMAEEKEDPLSHFHMDTLLMTTHNLLFGGT   300
XP_005616608.1     251   DHQDSLDPRCPRDFIDCFLNKMAQEKQDPHSHFHMDTLLMTTHNLIFGGT   300
NP_031843.2        251   EHQDSLDPNSPRDFIDCFLTKMAQEKQDPLSHFNMDTLLMTTHNLLFGGT   300
NP_062176.1        251   EHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT   300


NP_000765.2        301   KTVSTTLHHAFLALMKYPKVQARVQEEIDLVVGRARLPALKDRAAMPYTD   350
XP_001139965.3     177   ETVGTTLRHAFLALMKYPKVQARVQEEIDLVVGRARLPALKDRAAMPYTD   226
NP_001035330.1     301   ETVGTTLRHAFLALMKYPKVQARVQEEIDLVVGRTRLPTLEDRAAMPYTD   350
XP_005616608.1     301   ETVGTTLRHAFLVLMKYPKVQARVQEEIDRVVGRARLPALEDRAAMPYTD   350
NP_031843.2        301   ETVGTTLRHAFLILMKYPKVQARVQEEIDRVVGRSRMPTLEDRTSMPYTD   350
NP_062176.1        301   ETVGTTLRHAFLILMKYPKVQARVQEEIDCVVGRSRMPTLEDRASMPYTD   350


NP_000765.2        351   AVIHEVQRFADIIPMNLPHRVTRDTAFRGFLIPKGTDVITLLNTVHYDPS   400
XP_001139965.3     227   AVIHEVQRFADIIPMNLPHRVTRDTAFRGFLIPKGTDVITLLNTVHYDPS   276
NP_001035330.1     351   AVIHEVQRFADIIPMNLPHRVIRDTAFRXFLIPKGTDIITLLNTVHYDPS   400
XP_005616608.1     351   AVIHEVQRFADVIPMNLPHRVIRDTPFRGFLLPKGTDIITLLNTVHYDPN   400
NP_031843.2        351   AVIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPKGTDVITLLNTVHYDSD   400
NP_062176.1        351   AVIHEVQRFADVIPMNLPHRVIRDTPFRGFLIPKGTDVITLLNTVHYDSD   400


NP_000765.2        401   QFLTPQEFNPEHFLDANQSFKKSPAFMPFSAGRRLCLGESLARMELFLYL   450
XP_001139965.3     277   QFLTPQEFNPEHFLDANQSFKKSPAFMPFSAGRRLCLGESLARMELFLYL   326
NP_001035330.1     401   QFLXPQEFNPEHFLDANQSFKKSPAFMPFSAGRRLCLGESLARMELFLYL   450
XP_005616608.1     401   QFLTPQEFNPEHFLDANQSFKKSPAFMPFSAGRRLCLGESLARMELFLYL   450
NP_031843.2        401   QFKTPQEFNPEHFLDDNHSFKKSPAFMPFSAGRRLCLGEPLARMELFIYF   450
NP_062176.1        401   QFKTPQEFNPEHFLDANQSFKKSPAFMPFSAGRRLCLGEPLARMELFIYL   450


NP_000765.2        451   TAILQSFSLQPLGAPEDIDLTPLSSGLGNLPRPFQLCLRPR   491
XP_001139965.3     327   TAILQSFSLQPLGAPEDIDLTPLSSGLGNLPGPFQLCLRPR   367
NP_001035330.1     451   TAILQSFSLQPLGAPEDIXLTPLSSGLGNLPRXFQLCLCPR   491
XP_005616608.1     451   TAILQSFSLQPLGAPEDIDLTPLSSGLGNLPRPFQLRLRTR   491
NP_031843.2        451   TSILQNFTLQPLVDPEDIDLTPLSSGLGNLPRPFQLCMHIR   491
NP_062176.1        451   TSILQNFTLHPLVEPEDIDLTPLSSGLGNLPRPFQLCMRIR   491


Protein Acc. Gene Organism
NP_000765.2 CYP2F1 H.sapiens
XP_001139965.3 LOC738883 P.troglodytes
NP_001035330.1 CYP2F1 M.mulatta
XP_005616608.1 LOC612477 C.lupus
NP_031843.2 Cyp2f2 M.musculus
NP_062176.1 Cyp2f4 R.norvegicus


Support Center