Display Settings:

Format

Send to:

Choose Destination
HomoloGene:7259. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_690605.1          1   MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESK   50
XP_508461.2          1   MTTPRNSVNGTFPAEPMKGSIAMQSGPKPLFRRMSSLVGPTQSFFMRESK   50
XP_001086364.1       1   MTTPRNSVNGTFPAEPMKGPIAMQPGPKPLLRRMSSLVGPTQSFFMRESK   50
NP_001041493.1       1   MTTPRNSMSGTLPVDPMKSPTAMYPVQKIIPKRMPSVVGPTQNFFMRESK   50
NP_001071322.1       1   MTTPRNSMVGAFPAEPLKGPIAMHAAQKVVPRRVPVVVGPTQSFFMREAK   50
NP_031667.1          1   -------MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESK   43
NP_001101048.1       1   MTTPRNSVSGPFPTEPTKGPLAMQPAQKVIPRRPSSLVGPTQSFFMRESK   50


NP_690605.1         51   TLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL   100
XP_508461.2         51   ALGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL   100
XP_001086364.1      51   ALGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL   100
NP_001041493.1      51   TLGAVQIMNGLFHIALGSLLMIHTDVCAPICITMWYPLWGGIMFIISGSL   100
NP_001071322.1      51   ALGAVQIMNGLFHIALGSLMLIHMDVYMPICVTLWYPLWGGIMFIISGSL   100
NP_031667.1         44   ALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSL   93
NP_001101048.1      51   ALGAVQIMNGLFHISLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSL   100


NP_690605.1        101   L-AATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKM   149
XP_508461.2        101   L-AATEKNSRKCMVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKM   149
XP_001086364.1     101   L-AATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKM   149
NP_001041493.1     101   L-AAADKNPRKSLVKGKMIMNSLSLFAAISGIIFLIMDIFNITISHFFKM   149
NP_001071322.1     101   L-AAAEKNSTQSMLTGRLIMNSLSLFAAISGIIFLIMDIFNMTISHFFKM   149
NP_031667.1         94   LAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKM   143
NP_001101048.1     101   LAAAAEKTSRKSLA-TKVIMSSLSLFAAISGIILSIMDILNITVSHFLKM   149


NP_690605.1        150   ESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLI   199
XP_508461.2        150   ESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLI   199
XP_001086364.1     150   ESLNFIRVHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLI   199
NP_001041493.1     150   ENLNLIKAPMPYVDIHNCDPANPSEKNSLSIQYCGSIRSVFLGVFAVMLI   199
NP_001071322.1     150   ENLNLIKTQVPYININNCERANPDENNSQSVEYCARIRFVFLSNFAVMMI   199
NP_031667.1        144   RRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLI   193
NP_001101048.1     150   ERLELIKTPKLYVDIYNCEPSNSSEKNSPSTQYCNSVQSVFLGILSVMLI   199


NP_690605.1        200   FAFFQELVIAGIVENEWKRTCSRPKSN-IVLLSAEEKKEQTIEIKEEVVG   248
XP_508461.2        200   FAFFQELVIAGIVENEWKRTCSRPKSN-IVLLSAEEKKEQTIEIKEEVVG   248
XP_001086364.1     200   FAFFQELVIAGIVENEWRRTCSRPKSS-VVLLSAEEKKEQVIEIKEEVVG   248
NP_001041493.1     200   FAFFQKLVTAGIVENEWKKLCSKPKSDVVVLLAAEEKKEQPIETTEEMVE   249
NP_001071322.1     200   FAFLQKLVTAGTVENEWKKLCSRPKAN-VVLLSAEEKKEQVIEIKEEVVE   248
NP_031667.1        194   SAFFQKLVTAGIVENEWKRMCTRSKSN-VVLLSAGEKNEQTIKMKEEIIE   242
NP_001101048.1     200   SAFFQKLVTAGVVENEWKRVCSRPKSN-VVLLSAGEKKEQTIKMKEEIIE   248


NP_690605.1        249   LTETSSQ------PKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIE   292
XP_508461.2        249   LTETSSQ------PKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIE   292
XP_001086364.1     249   LTETSSQ------PKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIE   292
NP_001041493.1     250   LTEIASQ------PKKEEDIEIIPVQ-EEEGELEINFAEPPQEQESSPIE   292
NP_001071322.1     249   QIEVAEQIEISSLPKNEEDIEIIPVQEEEEEEAEMNFPEPPQDQEDSPIE   298
NP_031667.1        243   LSGVSSQ------PKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVE   286
NP_001101048.1     249   LSGVSSQ------PKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVE   292


NP_690605.1        293   NDSSP   297
XP_508461.2        293   NDSSP   297
XP_001086364.1     293   NDSSP   297
NP_001041493.1     293   NDSIP   297
NP_001071322.1     299   NDSVP   303
NP_031667.1        287   NEIAP   291
NP_001101048.1     293   NEISP   297


Protein Acc. Gene Organism
NP_690605.1 MS4A1 H.sapiens
XP_508461.2 MS4A1 P.troglodytes
XP_001086364.1 MS4A1 M.mulatta
NP_001041493.1 MS4A1 C.lupus
NP_001071322.1 MS4A1 B.taurus
NP_031667.1 Ms4a1 M.musculus
NP_001101048.1 Ms4a1 R.norvegicus


Support Center