Display Settings:

Format

Send to:

Choose Destination
HomoloGene:7105. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_060561.3          1   -------------------------------------------------M   1
XP_001165532.1       1   -------------------------------------------------M   1
XP_001110226.1       1   -------------------------------------------------M   1
XP_534563.3          1   -------------------------------------------------M   1
NP_001124234.1       1   -------------------------------------------------M   1
NP_083087.1          1   -------------------------------------------------M   1
XP_002728336.1       1   -------------------------------------------------M   1
NP_001034382.1           --------------------------------------------------
NP_001014344.2       1   ------------------------------------------------MG   2
NP_608834.1          1   -----------------------------------------------MKA   3
XP_317165.4          1   -----------------------------------------------MTK   3
NP_506055.2              --------------------------------------------------
NP_015239.1          1   ------------------------------------------MARHGKGP   8
XP_455030.1          1   ------------------------------------------MGRKGKGP   8
NP_986867.1          1   MSRDLWSRCSLVLKSFRLLPCDEVEQARRKTRFCESSTPVLRMGGKVKGE   50
NP_594862.1              --------------------------------------------------
XP_003710346.1       1   ------------------------------------------MSTTTVAR   8
XP_961595.1          1   ----------------------------------------MATTTVTVTR   10
NP_568725.1          1   ----------------------------MATAVVMNG-------ELKKQP   15
NP_001053128.1       1   ----------------------------MATAVAAAGGGGGGEQPRRRKP   22
NP_001001215.1       1   ----------------------------------------------MKPD   4


NP_060561.3          2   RQKRKG-----DLSPAELMMLTIGDVIKQLIEAHEQG--------KDIDL   38
XP_001165532.1       2   RQKRKG-----DLSPAELMMLTIGDVIKQLIEAHEQG--------KDIDL   38
XP_001110226.1       2   RQKRKG-----DLSPAELMMLTIGDVIKQLIEAHEQG--------KDIDL   38
XP_534563.3          2   RQKRKG-----DLSPAELMMLTIGDVIKQLIEAHEQG--------KDIDL   38
NP_001124234.1       2   RQKRKG-----DLSPAQLMMLTIGDVIKQLIEAHEQG--------KDIDL   38
NP_083087.1          2   RQKRKG-----DLSPAELMMLTIGDVIKQLVEAHEQG--------KDVDL   38
XP_002728336.1       2   KQKRKG-----DLSPAELMMLTIGDVIKQLVEAHEQG--------KDVDL   38
NP_001034382.1       1   MGQKRK-----DLSHAELMMMTIADIIKQLIEAHEQG--------KDVNL   37
NP_001014344.2       3   KPKKKS-----DLSRAELMMMTIADVIKQLVEAHEEG--------KDINL   39
NP_608834.1          4   KKKLGV-----GLSRQERQVLVIGEIIQELLKAHEAK--------KDVNL   40
XP_317165.4          4   KKPLGV-----GLSRDERMLIVVGEIIQELLKAHHEG--------KDVNL   40
NP_506055.2          1   MDQKG--------SQRALLAQTINEIVKLLIEAHNQK--------KDVNL   34
NP_015239.1          9   KTNKKK-----LAPEKERFIQCCADITLELTDSLTSGTT------REINL   47
XP_455030.1          9   KNNKQK-----LAPEKERFLQCCSDITIELISSLTGGSS------KEVNL   47
NP_986867.1         51   KNNRQK-----LASEKERFLQCCSDITVELVESLSNGST------REVNL   89
NP_594862.1          1   -MSTSS-----LAFLKAK---ACAEIVAELIAS--ENQN------KVINL   33
XP_003710346.1       9   PAASAT-----LAPEGERFLRCCADIANALIEDYEAAARDPKHRQKDVNL   53
XP_961595.1         11   SKKNAN-----LPSENDRFLRCCADIANALIEDHEAAQNG--RPQKDINL   53
NP_568725.1         16   RPGKGG-YQGRGLTEEEARVRAISEIVSTMIERSHRN--------ENVDL   56
NP_001053128.1      23   APGRGGVVLPAGLSEEEARVRAIAEIVSAMGELSRRG--------EDVDL   64
NP_001001215.1       5   RGPRGK-----Q-SQAELMMMTVADVIKQLVEAHEQG--------KDVNL   40


NP_060561.3         39   NKVKTKTAAKYGLSAQPRLVDIIAAV-PPQY-RKVLMPKLKAKPIRTASG   86
XP_001165532.1      39   NKVKTKTAAKYGLSAQPRLVDIIAAV-PPQY-RKVLIPKLKAKPIRTASG   86
XP_001110226.1      39   NKVKTKTAAKYGLSAQPRLVDIIAAV-PPQY-HKVLIPKLKAKPIRTASG   86
XP_534563.3         39   NKVKTRTAAKYGLSAQPRLVDIIAAV-PPQY-RKVLVPKLKAKPIRTASG   86
NP_001124234.1      39   NKVKTRTAAKYGLSAQPRLVDIIAAV-PPQY-RKVLVPKLKAKPIRTASG   86
NP_083087.1         39   NKMKTKTAAKYGLASQPRLVDIIAAV-PPHY-RKILIPKLKAKPVRTASG   86
XP_002728336.1      39   NKLKTKTASKYGLSSQPRLVDIIAAV-PPHY-RKILIPKLKAKPIRTASG   86
NP_001034382.1      38   NKLKTKTSAKYGLSAQPRLVDIIAAV-PPQH-RKALVPKLKAKPIRTASG   85
NP_001014344.2      40   NKVKTKTSAKYGLSAQPRLVDIIAAV-PPHY-RRALVPKLKAKPIRTASG   87
NP_608834.1         41   NRMKSLVASKYGLDSSPRLVDIIAAV-PQDA-KKILLPKLRAKPIRTASG   88
XP_317165.4         41   NRLKTRISSNYGLESAPRLVDIIAAV-PHEA-KSILLPKLRAKPIRTASG   88
NP_506055.2         35   NRLKCIVAQKNGLSFQPKLVDIIAGV-PSDY-KDSLLPKLKAKPVRTASG   82
NP_015239.1         48   NGLITKYSKKYKLKQQPRLTDIINSI-PDQY-KKYLLPKLKAKPVRTASG   95
XP_455030.1         48   NGLITRYSKRYKLKQQPRLTDIINSI-PDQH-KKYLLPKLKAKPVRTASG   95
NP_986867.1         90   NGLITRYSKKYRLKQQPRLTDIINSI-PDQH-KKYLLPKLKAKPVRTASG   137
NP_594862.1         34   NALKMRISKKHQLSESPRLTDIIAAIPPDAYLKESLMRKLRAKPVRTASG   83
XP_003710346.1      54   NSLRGKFSRKHKLKKIPPLTAIIAAV-PEHY-KKYILPKLIAKPIRTSSG   101
XP_961595.1         54   NSLRSKFAKKHKINNVPPLTAIIAAV-PEHY-KKYILPRLIAKPIRTSSG   101
NP_568725.1         57   NAIKTAACRKYGLARAPKLVEMIAAL-PDSE-RETLLPKLRAKPVRTASG   104
NP_001053128.1      65   NALKSAACRRYGLARAPKLVEMIAAV-PEAD-RAALLPRLRAKPVRTASG   112
NP_001001215.1      41   NKLKTKTSAKYGLSAQPRLVDIIAAV-PPQY-RKILVPKLKAKPIRTASG   88


NP_060561.3         87   IAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   136
XP_001165532.1      87   IAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   136
XP_001110226.1      87   IAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   136
XP_534563.3         87   IAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   136
NP_001124234.1      87   IAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   136
NP_083087.1         87   IAVVAVMCKPHRCPHISFTGNICIYCPGGPDSDFEYSTQSYTGYEPTSMR   136
XP_002728336.1      87   IAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   136
NP_001034382.1      86   IAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   135
NP_001014344.2      88   IAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   137
NP_608834.1         89   IAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   138
XP_317165.4         89   IAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   138
NP_506055.2         83   IAVVAVMSKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   132
NP_015239.1         96   IAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   145
XP_455030.1         96   IAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   145
NP_986867.1        138   IAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   187
NP_594862.1         84   IAVVAVMCKPHRCPHIAMTGNVCVYCPGGPDSDFEYSTQSYTGYEPTSMR   133
XP_003710346.1     102   IAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   151
XP_961595.1        102   IAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   151
NP_568725.1        105   IAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   154
NP_001053128.1     113   IAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   162
NP_001001215.1      89   IAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR   138


NP_060561.3        137   AIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   186
XP_001165532.1     137   AIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   186
XP_001110226.1     137   AIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   186
XP_534563.3        137   AIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   186
NP_001124234.1     137   AIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   186
NP_083087.1        137   AIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   186
XP_002728336.1     137   AIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   186
NP_001034382.1     136   AIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEDYRDYFI   185
NP_001014344.2     138   AIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFI   187
NP_608834.1        139   AIRSRYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLPEEYRDYFI   188
XP_317165.4        139   AIRARYHPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLPEDYRDFFI   188
NP_506055.2        133   AIRARYNPYLQTRGRLNQLMQLGHSVDKVEFIVMGGTFMSLPEDYRDFFI   182
NP_015239.1        146   AIRARYDPYEQARGRVEQLKQLGHSIDKVEYVLMGGTFMSLPKEYREDFI   195
XP_455030.1        146   AIRARYDPYEQARGRIEQLKQLGHSIDKVEYIIMGGTFMSLPKDYREDFI   195
NP_986867.1        188   AIRARYDPYEQARGRVEQLKQLGHSIDKVEYIIMGGTFMSLPREYREDFI   237
NP_594862.1        134   AIRARYDPYEQARGRVEQLRSLGHTVDKVEYIIMGGTFMSLPESYRHTFI   183
XP_003710346.1     152   AIRARYDPFEQARGRVDQLKALGHSVDKVEYIIMGGTFMSLPESYRDDFI   201
XP_961595.1        152   AIRARYDPFEQARGRVDQLKSLGHSVDKVEYIIMGGTFMSLPESYRDEFI   201
NP_568725.1        155   AIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPAEYRDFFI   204
NP_001053128.1     163   AIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFI   212
NP_001001215.1     139   AIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALSEDYRDFFI   188


NP_060561.3        187   RNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDML   236
XP_001165532.1     187   RNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDML   236
XP_001110226.1     187   RNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDML   236
XP_534563.3        187   RNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDML   236
NP_001124234.1     187   RNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDML   236
NP_083087.1        187   RSLHDALSGHTSNNIHEAIKYSERSFTKCVGITIETRPDYCMKRHLSDML   236
XP_002728336.1     187   RNLHDALSGHTSNNIYEAIKYSERSLTKCIGITIETRPDYCMKRHLSDML   236
NP_001034382.1     186   RNLHDALSGHTSNNVAEAVKYSERSLTKCVGITIETRPDYCLKRHLSDML   235
NP_001014344.2     188   RNLHDALSGHTSNNVTEAVRYSERSNTKCVGITIETRPDYCLKRHLSDML   237
NP_608834.1        189   RNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDML   238
XP_317165.4        189   RNLHDALSGHTSSSVAEAVKYSEKSHTKCIGITIETRPDYCLKRHLSDLL   238
NP_506055.2        183   RNLHDALSGHTSASVEEAVAYSERSKMKCIGITIETRPDYCLPRHLNDML   232
NP_015239.1        196   VKLHNALSGFNGNDIDEAILYSQQSLTKCVGITIETRPDYCTQTHLDDML   245
XP_455030.1        196   VKLHNALSGFNGNDIDEAIQYSQQSLTKCVGITIETRPDYCTQTHLDDML   245
NP_986867.1        238   VKLHNALSGFNGSDIDEAIRYSQQSLTKCVGITIETRPDYCTRTHLDDML   287
NP_594862.1        184   ANLHNALSGATTEDLDEAVKFSEQSETKCVGITIETRPDYCLDQHLDEML   233
XP_003710346.1     202   SQLHNALSGYQTSNVDEAVEAGEMSNVKCVGITIETRPDYCLQPHLSSML   251
XP_961595.1        202   SQLHNALSGYGTLNVDEAVRSGEQSNIKCVGITIETRPDYCLQPHLSSML   251
NP_568725.1        205   RNLHDALSGHTSANVEEAVAYSEHSATKCIGMTIETRPDYCLGPHLRQML   254
NP_001053128.1     213   RNLHDALSGHTSANVEEAVCYSEHGAVKCIGMTIETRPDYCLGPHLRQML   262
NP_001001215.1     189   RNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDML   238


NP_060561.3        237   TYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMM   286
XP_001165532.1     237   TYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMM   286
XP_001110226.1     237   TYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMM   286
XP_534563.3        237   TYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMM   286
NP_001124234.1     237   TYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMM   286
NP_083087.1        237   TYGCTRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKVVTHMM   286
XP_002728336.1     237   TYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMM   286
NP_001034382.1     236   SYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMM   285
NP_001014344.2     238   GYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMM   287
NP_608834.1        239   SYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMM   288
XP_317165.4        239   SYGCTRLEIGVQSVYEDVARDTNRGHTVKATCESFQMSKDAGFKVVSHMM   288
NP_506055.2        233   LYGCTRLEIGVQSTYEDVARDTNRGHTVKSVCETFHMAKDTGYKVVIHMM   282
NP_015239.1        246   KYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMM   295
XP_455030.1        246   KYGCTRLEIGVQSLYEDVARDTNRGHTVQSVCETFAVAKDAGYKIVSHMM   295
NP_986867.1        288   KYGCTRLEIGVQSLYEDVARDTNRGHTVKSVCETFAVAKDAGYKIVSHMM   337
NP_594862.1        234   RYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFQLAKDTGYKVVTHMM   283
XP_003710346.1     252   RYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHMM   301
XP_961595.1        252   RYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHMM   301
NP_568725.1        255   IYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMM   304
NP_001053128.1     263   SYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMM   312
NP_001001215.1     239   SYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMM   288


NP_060561.3        287   PDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGR   336
XP_001165532.1     287   PDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGR   336
XP_001110226.1     287   PDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGR   336
XP_534563.3        287   PDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGR   336
NP_001124234.1     287   PDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGR   336
NP_083087.1        287   PDLPNVGLERDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGR   336
XP_002728336.1     287   PDLPNVGLERDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGR   336
NP_001034382.1     286   PDLPNMGLERDTDQFVEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGR   335
NP_001014344.2     288   PDLPNVGMERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGR   337
NP_608834.1        289   PDLPNVDFERDIEQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGR   338
XP_317165.4        289   PDLPNVDIERDIEQFIEFFENPDFRADGLKIYPTLVIRGTGLYELWKTGR   338
NP_506055.2        283   PDLPNVGLERDKEQFLELFESPAFRPDGLKLYPTLVIRGTGLYELWKTGR   332
NP_015239.1        296   PDLPNVGMERDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGR   345
XP_455030.1        296   PDLPNVGMERDIEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELWKTGR   345
NP_986867.1        338   PDLPNVGMERDIEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELWKTGR   387
NP_594862.1        284   PDLPNVGMERDIFQFQEYFENPAFRTDGLKLYPTLVIRGTGLYELWKTGR   333
XP_003710346.1     302   PDLPNVGMERDVDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGR   351
XP_961595.1        302   PDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGR   351
NP_568725.1        305   PDLPNVGVERDMESFKEFFESPSFRADGLKIYPTLVIRGTGLYELWKTGR   354
NP_001053128.1     313   PDLPNVGVERDLESFREFFENPAFRADGLKIYPTLVIRGTGLYELWKTGR   362
NP_001001215.1     289   PDLPNVGLERDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGR   338


NP_060561.3        337   YKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   386
XP_001165532.1     337   YKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   386
XP_001110226.1     337   YKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   386
XP_534563.3        337   YKSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   386
NP_001124234.1     337   YKSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   386
NP_083087.1        337   YRSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   386
XP_002728336.1     337   YRSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVDHGNLREL   386
NP_001034382.1     336   YKSYPPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   385
NP_001014344.2     338   YKSYSPSALVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   387
NP_608834.1        339   YKSYPPSMLVDLVAKILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   388
XP_317165.4        339   YKSYPPSTLVDLVAKILALVPPWTRVYRVQRDIPMPLVTSGVEHGNLREL   388
NP_506055.2        333   YQSYPPSVLVDLIATILSLVPPWTRVYRVQRDIPMPLVSSGVEHGNLREH   382
NP_015239.1        346   YKSYSANALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVDNGNLREL   395
XP_455030.1        346   YKSYNANALVDLVARIMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLREL   395
NP_986867.1        388   YKSYNANALVDLVARIMALVPPWTRIYRVQRDIPMPLVTSGVENGNLREL   437
NP_594862.1        334   YKNYTPNALVDLIARILALVPPWTRIYRIQRDIPMPLVSSGVETGNLREL   383
XP_003710346.1     352   YQNYTPNGLIDLVARILALVPPWTRIYRVQRDIPMPLVSSGVENGNLREL   401
XP_961595.1        352   YQNYTPNGLIDLVARIMALVPPWTRIYRVQRDIPMPLVTSGVENGNLREL   401
NP_568725.1        355   YRNYPPEQLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLREL   404
NP_001053128.1     363   YRNYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLREL   412
NP_001001215.1     339   YRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLREL   388


NP_060561.3        387   ALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETF   436
XP_001165532.1     387   ALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETF   436
XP_001110226.1     387   ALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETF   436
XP_534563.3        387   AFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETF   436
NP_001124234.1     387   AFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETF   436
NP_083087.1        387   AFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQVELVRRDYVANGGWETF   436
XP_002728336.1     387   AFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQVELVRRDYVANGGWETF   436
NP_001034382.1     386   ALARMKDLGTQCRDVRTREVGIQEIHHKVRPYQIELIRRDYVANGGWETF   435
NP_001014344.2     388   ALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETF   437
NP_608834.1        389   ALARMKDLGTTCRDVRTREVGIQEIHNKVRPYEIELIRRDYVANGGWETF   438
XP_317165.4        389   ALARMKDLGTDCRDVRTREVGIQEIHNKVRPDQVELIRRDYVANGGWETF   438
NP_506055.2        383   AMAKMKELGLKCRDVRTREVGIQEIHNKVRPEDVELIRRDYTANGGWETF   432
NP_015239.1        396   ALARMKDLGTTCRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETF   445
XP_455030.1        396   ALARMKDFGTTSRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETF   445
NP_986867.1        438   ALARMKDFGTTCRDVRTREVGIQEVHHKVHPEQVELIRRDYYANGGWETF   487
NP_594862.1        384   ALNRMRDLGTKCRDIRAREVGMQEVHHKIHPEQVELLRRDYTANGGWETF   433
XP_003710346.1     402   ALARMKDFGTTCRDVRTREVGINEVKHKIRPNQVELVRRDYVANGGWETF   451
XP_961595.1        402   ALARMKDFGTTCRDVRTREVGVNEVKNKIRPNQIELVRRDYTANGGWETF   451
NP_568725.1        405   ALARMDDLGLKCRDVRTREAGIQDIHHKIKPEQVELVRRDYTANEGWETF   454
NP_001053128.1     413   ALARMEDLGLKCRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETF   462
NP_001001215.1     389   ALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETF   438


NP_060561.3        437   LSYEDPDQDILIGLLRLRKCSEE-TFRFELGGG-VSIVRELHVYGSVVPV   484
XP_001165532.1     437   LSYEDPDQDILIGLLRLRKCSEE-TFRFELGGG-VSIVRELHVYGSVVPV   484
XP_001110226.1     437   LSYEDPDQDILIGLLRLRKCSEE-TFRFELGGG-VSIVRELHVYGSVVPV   484
XP_534563.3        437   LSYEDPDQDILIGLLRLRKCSEE-TFRFELVGG-VSIVRELHVYGSVVPV   484
NP_001124234.1     437   LSYEDPDQDILIGLLRLRKCSEE-TFRFELVGG-VSIVRELHVYGSVVPV   484
NP_083087.1        437   LSYEDPDQDILIGLLRLRKCSEE-TFRFELGGG-VSIVRELHVYGSVVPV   484
XP_002728336.1     437   LSYEDPDQDILIGLLRLRKCSEE-TFRFELGGG-VSIVRELHVYGSVVPV   484
NP_001034382.1     436   LSYEDPEQDILVGLLRLRKCSEE-SFRPELKGG-VSIVRELHVYGSVVPV   483
NP_001014344.2     438   LSYEDPEQDILIGLLRLRRCSPQ-SFRPELKGG-VSIVRELHVYGSVVPV   485
NP_608834.1        439   LSYEDPEQDILVGLLRLRKCSPD-TFRPELKGE-CSIVRELHVYGSVVPV   486
XP_317165.4        439   LSYEDPKQDILVGLLRLRKCSPD-TFRPELVDS-CSIVRELHVYGSVVPV   486
NP_506055.2        433   ISYEDPKQDILIGLLRLRKISDK-AHRPELKGN-VSVVRELHVYGSVVSV   480
NP_015239.1        446   LSYEDPKKDILIGLLRLRKASKKYTYRKEFTSQRTSIVRELHVYGSVVPL   495
XP_455030.1        446   LSYEDPKQDILIGLLRLRKASKKYTYRKEFTSQRTSIVRELHVYGSVVPL   495
NP_986867.1        488   LSYEDPKQDILIGLLRLRKASKKYTYRKEFTAQRTSIVRELHVYGSVVPL   537
NP_594862.1        434   LSYEDPKQDILIGLLRLRQCSDK-TYRPEFTSQPTSLVRELHVYGSAVPV   482
XP_003710346.1     452   LAYEDPKQDILIGLLRLRKCTEKYTFREELTGQPTSLVRELHVYGTAVPV   501
XP_961595.1        452   LAYEDPKQDILVGLLRLRKCSEKYTFREELVGQPTSLVRELHVYGMAVPL   501
NP_568725.1        455   LSYEDTRQDILVGLLRLRKCGKN-VTCPELMGK-CSVVRELHVYGTAVPV   502
NP_001053128.1     463   LSYEDTQQDILIGLLRLRKCGRN-VTCPELVGR-CSIVRELHVYGTAVPV   510
NP_001001215.1     439   LSYEDPEQDILIGLLRLRKCSEQ-SFRPELKGG-VSIVRELHVYGSVVPI   486


NP_060561.3        485   SSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIG   534
XP_001165532.1     485   SSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIG   534
XP_001110226.1     485   SSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIG   534
XP_534563.3        485   SSRDPTKFQHQGFGMLLMEEAERIAREEHGSGRIAVISGVGTRNYYRKIG   534
NP_001124234.1     485   SSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIG   534
NP_083087.1        485   SSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKMAVISGVGTRNYYRKIG   534
XP_002728336.1     485   SSRDPTKFQHQGFGMLLMEEAERIALEEHGSGKIAVISGVGTRNYYRKMG   534
NP_001034382.1     484   SSRDPSKFQHQGFGMLLMEEAERIAKEEHGSWKIAVISGVGTRNYYRKIG   533
NP_001014344.2     486   SSRDPSKFQHQGFGMMLMEEAERIARDEHGSSKLAVISGVGTRNYYRKMG   535
NP_608834.1        487   NARDPTKFQHQGFGMLLMEEAERIAREEHGSTKLAVISGVGTRNYYRKMG   536
XP_317165.4        487   NARDPTKFQHQGFGMLLMEEAERIAREEHGSKKLAVISGVGTRNYYRKIG   536
NP_506055.2        481   ADRDPKKFQHQGYGSLLMEEAERIAREEHGSDKIAVISGVGTREYYRKLG   530
NP_015239.1        496   HSRDPRKFQHQGFGTLLMEEAERIAKEEHGSEKISVISGVGVRNYYGKLG   545
XP_455030.1        496   HSRDPRKFQHQGFGTLLMEEAEKIAREEHGSEKISVISGVGVRNYYAKLG   545
NP_986867.1        538   HSRDPRKFQHQGFGTLLMEEAERIAREEHGSQKISVISGVGVRNYYARLG   587
NP_594862.1        483   HSRDPKKFQHQGFGTLLLEEAERIAKYEHGSKKISVISGVGVRKYYQKLG   532
XP_003710346.1     502   HARDPKKFQHQGFGTLLMEEAERIARDEHGSEKISVISGVGVRSYYKKLG   551
XP_961595.1        502   HVRDPRKFQHQGFGTLLMEEAERIARDEHGSVKISVISGVGVRSYYRKLG   551
NP_568725.1        503   HGRDADKLQHQGYGTLLMEEAERIARREHRSNKIGVISGVGTRHYYRKLG   552
NP_001053128.1     511   HGRDADKLQHQGYGTLLMEEAERIARKEHRSKKIAVISGVGTRHYYRKLG   560
NP_001001215.1     487   SSRDPSKFQHQGFGMLLMEEAERIAREEHGSCKIAVISGVGTRNYYRKLG   536


NP_060561.3        535   YRLQGPYMVKMLK-------   547
XP_001165532.1     535   YRLQGPYMVKMLK-------   547
XP_001110226.1     535   YRLQGPYMVKMLK-------   547
XP_534563.3        535   YRLQGPYMVKTLK-------   547
NP_001124234.1     535   YRLQGPYMVKTLE-------   547
NP_083087.1        535   YRLQGPYMVKMLK-------   547
XP_002728336.1     535   YRLQGPYMVKMLK-------   547
NP_001034382.1     534   YELEGPYMVKRLQ-------   546
NP_001014344.2     536   YELEGPYMVKNLY-------   548
NP_608834.1        537   YQLDGPYMSKSIEENN----   552
XP_317165.4        537   YELDGPFMSKML--------   548
NP_506055.2        531   YELDGPYMSKMLDSAAA---   547
NP_015239.1        546   YELDGPYMSKRI--------   557
XP_455030.1        546   YELDGPYMSKRLYQEC----   561
NP_986867.1        588   YELDGPYMSKSLI-------   600
NP_594862.1        533   YTLDGPYMSKWL--------   544
XP_003710346.1     552   YWLDGPYMSKWLDGRPGN--   569
XP_961595.1        552   YWLDGPYMSKWLDGRPGPEE   571
NP_568725.1        553   YELEGPYMVKHLL-------   565
NP_001053128.1     561   YELEGPYMVKCLV-------   573
NP_001001215.1     537   YELEGPYMVKKLD-------   549


Protein Acc. Gene Organism
NP_060561.3 ELP3 H.sapiens
XP_001165532.1 ELP3 P.troglodytes
XP_001110226.1 ELP3 M.mulatta
XP_534563.3 ELP3 C.lupus
NP_001124234.1 ELP3 B.taurus
NP_083087.1 Elp3 M.musculus
XP_002728336.1 LOC100362548 R.norvegicus
NP_001034382.1 ELP3 G.gallus
NP_001014344.2 elp3 D.rerio
NP_608834.1 Elp3 D.melanogaster
XP_317165.4 AgaP_AGAP008300 A.gambiae
NP_506055.2 elpc-3 C.elegans
NP_015239.1 ELP3 S.cerevisiae
XP_455030.1 KLLA0E23937g K.lactis
NP_986867.1 AGOS_AGR201C E.gossypii
NP_594862.1 elp3 S.pombe
XP_003710346.1 MGG_05481 M.oryzae
XP_961595.1 NCU01229 N.crassa
NP_568725.1 ELO3 A.thaliana
NP_001053128.1 Os04g0484900 O.sativa
NP_001001215.1 elp3 X.tropicalis


Support Center