Display Settings:

Format

Send to:

Choose Destination
HomoloGene:68548. Gene conserved in Opisthokonta Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_009102.3              --------------------------------------------------
NP_001233574.1           --------------------------------------------------
XP_002799997.1           --------------------------------------------------
XP_849854.1              --------------------------------------------------
NP_001073799.1           --------------------------------------------------
NP_660127.1              --------------------------------------------------
NP_445858.1              --------------------------------------------------
NP_001025856.1           --------------------------------------------------
NP_001041532.2           --------------------------------------------------
NP_524025.2          1   MSATYTNTITQRRKTAKVRQQQQHQWTGSDLSGESNERLHFRSRSTNSMQ   50
XP_318526.4          1   METPVSEATDTTTTALRSRKAQKKAQKGSEESATVNEQRSPSMETAVKER   50
NP_012677.1          1   MSVPKKRNHGKLPPSTKDV--DDPSLKYTKA----AP-------------   31
XP_451701.1          1   MVVSKRSKTPAFADKKGDVVEKDEIDKYVKSGKFNEG-------------   37
NP_982862.2          1   MASKKSQK-----AASVER--DDSAAKRGKA----EG-------------   26
NP_596807.1          1   MASKSEKAVKKAQKLSKEPSVELTDTKSSDN----VT-------------   33
XP_003713520.1       1   MASSPATPQGSLRQRNVPGASKKNDEKSSQP-------------------   31
XP_963926.2          1   MASTTATPEATLRQRNVPASSKKAKNGVSSD-------------------   31
NP_001006756.1           --------------------------------------------------


NP_009102.3              --------------------------------------------------
NP_001233574.1           --------------------------------------------------
XP_002799997.1           --------------------------------------------------
XP_849854.1              --------------------------------------------------
NP_001073799.1           --------------------------------------------------
NP_660127.1              --------------------------------------------------
NP_445858.1              --------------------------------------------------
NP_001025856.1           --------------------------------------------------
NP_001041532.2           --------------------------------------------------
NP_524025.2         51   QHTAISNSPSPLCCNGARALTMLNCCVDVNCHLNAPLRGSVNRHTTPTPT   100
XP_318526.4         51   HHKLKSDEPE----------------------------------------   60
NP_012677.1              --------------------------------------------------
XP_451701.1              --------------------------------------------------
NP_982862.2              --------------------------------------------------
NP_596807.1              --------------------------------------------------
XP_003713520.1           --------------------------------------------------
XP_963926.2              --------------------------------------------------
NP_001006756.1           --------------------------------------------------


NP_009102.3          1   ------------------------------------MWGFLKR-------   7
NP_001233574.1       1   ------------------------------------MWGFLKR-------   7
XP_002799997.1       1   ------------------------------------MWGFLKR-------   7
XP_849854.1          1   ------------------------------------MLGFLKR-------   7
NP_001073799.1       1   ------------------------------------MLGFLQQ-------   7
NP_660127.1          1   --------------MGSHSTGLEETLGVLPSWLFCKMLRFLKR-------   29
NP_445858.1          1   --------------MGNRSMGREDTLGVLPSLLFCKMLRFLKR-------   29
NP_001025856.1       1   ------------------------------------MLGFLKN-------   7
NP_001041532.2       1   -------------------------------------MQCVKL-------   6
NP_524025.2        101   PTATPTPVATPKQASPSPTSDRSRSLSRSPSPSRSRSLSCQKQIDKNSAG   150
XP_318526.4         61   --------------------------KRSPAEAISERNGAFEEVDDR---   81
NP_012677.1         32   --------------------------K---CEQVAEHWLLQPL-------   45
XP_451701.1         38   --------------------------KGTGIEYIAEKWLLRSA-------   54
NP_982862.2         27   --------------------------R---YEYMGERWLQRPA-------   40
NP_596807.1         34   --------------------------PKQKSPNSTEEDVSLNL-------   50
XP_003713520.1      32   ------------------------------VDLKDIKKAAKGQ-------   44
XP_963926.2         32   ------------------------------VETDKVPDAVAPA-------   44
NP_001006756.1       1   ------------------------------------MAVSLKS-------   7


NP_009102.3          8   ---------------PVVVTADINLSLVA--LTGMGLLSRLWRLTYPRAV   40
NP_001233574.1       8   ---------------PVVVTADINLSLVA--LTGMGLLSRLWRLTYPRAV   40
XP_002799997.1       8   ---------------PIVVTADINLSLVA--LTGMGLLSRLWRLTYPPAV   40
XP_849854.1          8   ---------------PVVVTADINLNVVA--LTAVGLLSRLWHLAYPRAV   40
NP_001073799.1       8   ---------------PVMVTAEVNLNMVA--LTAVGLLSRLWQLAYPRAV   40
NP_660127.1         30   ---------------PLVVTVDINLNLVA--LTGLGLLTRLWQLSYPRAV   62
NP_445858.1         30   ---------------PLVVTIDINLNLVA--LTVLGLLTRLWQLSYPRAV   62
NP_001025856.1       8   ---------------PVVVTAEINLNLVV--LTVMGLISRLWGLSYPRAV   40
NP_001041532.2       7   ---------------PVSVTVEINVLLLA--VTALALFTRLYGIHFPKAV   39
NP_524025.2        151   AASAEERKTANASSQPFTVNLRIDLFSWT--LFLLAFGTRFYKLATPPHI   198
XP_318526.4         82   ----------------FSISIRLQFNAATVGLFLVSFLTRFYRITHPRGV   115
NP_012677.1         46   ---------------P-EPESRYSFWVTI--VTLLAFAARFYKIWYPKEV   77
XP_451701.1         55   ---------------P-DSATLYKVMNYL--VTGLALVLRLWRISEPREV   86
NP_982862.2         41   ---------------P-DSNLKYKYYGYM--VTAIAFAVRFHKLYHPSEV   72
NP_596807.1         51   ---------------KTLKAKKFKLAFVL--ITVLSFITRFWNLNLPGEV   83
XP_003713520.1      45   ---------------PVGPERDHQAAFTV--ITVLAFITRFWGISHPNEV   77
XP_963926.2         45   ---------------KSGSELEYKLALIL--ITGLAFLTRFWGISHPDEV   77
NP_001006756.1       8   ---------------PLVVTVAIDLHFVA--LTILGLVSRLWRLSYPQAV   40


NP_009102.3         41   VFDEVYYGQYISFYMKQIFFLDDSGPPFGHMVLALGGYLGGFDGNFLWNR   90
NP_001233574.1      41   VFDEVYYGQYISFYMKQIFFLDDSGPPFGHMVLALGGYLGGFDGNFLWNR   90
XP_002799997.1      41   VFDEVYYGQYISFYMKRIFFLDDSGPPFGHMVLALGGYLGGFDGHFLWNR   90
XP_849854.1         41   VFDEVYYGQYISFYMKRIFFLDGSGPPFGHMLLALGGYLGGFDGNFLWNR   90
NP_001073799.1      41   VFDEVYYGQYISFYMKRIFFLDGSGPPFGHMLLALGGYLGGFDGNFLWNR   90
NP_660127.1         63   VFDEVYYGQYISFYMKRIFFLDDSGPPFGHMLLALGGWLGGFDGNFLWNR   112
NP_445858.1         63   VFDEVYYGQYISFYMKRVFFLDDSGPPFGHMLLALGGWLGGFDGNFLWNR   112
NP_001025856.1      41   VFDEVYYGQFVSLYMKRIFFVDDSGPPLGHMLLALGGYLGGFDGNFLWNR   90
NP_001041532.2      40   VFDEVYYGQFLSLYMKQVFFIDESGPPFGHMILALGAYLGGFDGNFVWNR   89
NP_524025.2        199   VFDELHYGKYISMYMRNIFFFDQH-PPLGKQLIAGLVSLAGYDGNYTFTR   247
XP_318526.4        116   VFDEIHFGKFVSLYLKNTFYFDQH-PPLGKLMIAGAAGAVGYSGSFEFPK   164
NP_012677.1         78   VFDEVHFGKFASYYLERSYFFDVH-PPFAKMMIAFIGWLCGYDGSFKFDE   126
XP_451701.1         87   VFDEVHFGKFASYYLERTYFFDVH-PPMAKMLIAAIGWLTGYNGSFKFDD   135
NP_982862.2         73   VFDEVHFGKFASYYLERTYFFDVH-PPFSKMLIAFVGWLVGYDGAFKFDD   121
NP_596807.1         84   VFDEVHFGKFASYYLQGKYFFDLH-PPFAKLLLALVAKLAGYDGHYLFDN   132
XP_003713520.1      78   VFDEVHFGKFASYYLQKTYFFDVH-PPFGKLLFAFMGWLVGYDGHFHFDN   126
XP_963926.2         78   VFDEVHFGKFASYYLERTYFFDVH-PPFGKLLFAFMGWLVGYDGHFHFEN   126
NP_001006756.1      41   VFDEVYYGQFISLYMKRIFYLDDSGPPLGHMLLALGGYVADFDGNFMWNR   90


NP_009102.3         91   IGAEYSSN-VPVWSLRLLPALAGALSVPMAYQIVLELHFSHCAAMGAALL   139
NP_001233574.1      91   IGAEYSSN-VPVWSLRLLPALAGALSVPMAYQIVLELHFSHCAAMGAALL   139
XP_002799997.1      91   IGAEYSSN-VPVWSLRLLPALAGALSVPMAYQIVLELHFSHCAAMGAALL   139
XP_849854.1         91   IGAEYSSN-VPVWSLRLLPALTGAFSIPMAYQILLELGFSHCAAMGAALL   139
NP_001073799.1      91   IGAEYSSN-VPVWSLRLLPALSGALSVPMAYEIVWELGFSHCAATGAALL   139
NP_660127.1        113   IGAEYSSN-VPIWSLRLLPALAGALSVPMAYQIVLELHFSHGAAIGAALL   161
NP_445858.1        113   IGAEYSSN-VPVWSLRLLPALAGALSVPMAYQIVLELHFSHCTAMGAALL   161
NP_001025856.1      91   IGAEYSMN-VPVWSLRFLPALAGALCIPLAYQILVELQFSHCAALGAALL   139
NP_001041532.2      90   IGAEYPGN-VPVWSLRLIPALAGSFCVPLAYLVVVELGYSHFSALGACAL   138
NP_524025.2        248   IGEPYSPE-MPIFWFRFLPAMCGSLLAPAVYNLLLEAKLSRWSSALGGLL   296
XP_318526.4        165   IGSEYDAS-VPILALRFVPALCGSLLAPIVYSILRQVKLGQGVSILGGLL   213
NP_012677.1        127   IGYSYETHPAPYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASLL   176
XP_451701.1        136   IGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIAAFL   185
NP_982862.2        122   IGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALL   171
NP_596807.1        133   IGDNYKDNGVPYVTIRAWPALLSSLVPPVVFLIMKESGYDLLACIVSSSL   182
XP_003713520.1     127   IGDSYVVNKVPYVAFRSLPALLGALTVSVVYLIMWESGYSVPACILAAGL   176
XP_963926.2        127   IGDSYIRNKVPYVAFRSLPAILGALTVSVVYMIMWESGYSLPACLIAAGL   176
NP_001006756.1      91   IGAEYSSN-VPVWSLRLLPALSGALCVPLAYQIVVELGFSARAGLAAGFL   139


NP_009102.3        140   MLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHSPFSLSWWFW   189
NP_001233574.1     140   MLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHSPFSLSWWFW   189
XP_002799997.1     140   MLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHSPFSLSWWFW   189
XP_849854.1        140   MLIENALITQSRLMLLESVLIFFNLLAVLSYLKFSNSQKHRPFSLSWWFW   189
NP_001073799.1     140   LLIENALITQSRLMLLESVLIFFNLLAVLSYLKFCNSQKHRPFSPRWWFW   189
NP_660127.1        162   MLIENALITQSRLMLLESILIFFNLLAVLSYLKFFNSQTHSPFSVHWWLW   211
NP_445858.1        162   MLIENALITQSRLMLLESILIFFNLLAVLSYLKFFNSQTHSPFSVHWWLW   211
NP_001025856.1     140   ILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQRHSSFSGGWWFW   189
NP_001041532.2     139   LLMEDSLIVQSRFMLLESVLIFFLLLAVLSYLRFHKA-RNSSFK---WFW   184
NP_524025.2        297   VVLDNSLLTQSRFVLMESMLLLATTVGIACLLRF---QRSRLGSLEWFFT   343
XP_318526.4        214   IILDNALLTHSRFILMESMLLFFAALGILTVLKF---LQADPFSARWWTL   260
NP_012677.1        177   VAIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIW   226
XP_451701.1        186   IAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLW   235
NP_982862.2        172   VAVDNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFW   221
NP_596807.1        183   VLFDNAHVTEGRLILLDATLLFSMVCAIYCYVRFFKLR-HTPFSRPWWAW   231
XP_003713520.1     177   VLFDNAHIGQTRLILLDATLVFAFACSLLCYIKFYKMR-HEPFSRKWWKW   225
XP_963926.2        177   VLLDNAHIGQTRLILLDATLVFAMACSLLCYIKFHKLR-HEPFSRKWWKW   225
NP_001006756.1     140   LLFENALITQSRLMLLESVLIFFILLALLSYLKFHGCQRRSPFSVSWWFW   189


NP_009102.3        190   LTLTGVACSCAVGIKYMGVFTYVLVLGVAAVHAWHLLGDQ----TLSNVG   235
NP_001233574.1     190   LTLTGVACSCAVGIKYMGVFTYVLVLGVAAVHAWHLIGDQ----TLSN--   233
XP_002799997.1     190   LTLTGVACSCAVGIKYMGMFTYVLMLAVAAVHAWHLIGDQ----TLSNVG   235
XP_849854.1        190   LMLTGVACSCAVGVKYMGIFTYLLVLAVASVHAWHLIGDQ----TLSN--   233
NP_001073799.1     190   LVLTGVACSCAVGIKYVGVFTYLLVLGVAAVHAWHVIGDQ----TLSN--   233
NP_660127.1        212   LLLTGVSCSCAVGIKYMGIFTYLLVLGIAAVHAWNLIGDQ----TLSN--   255
NP_445858.1        212   LMLTGVSCSCAVGIKYMGIFTYLLVLSIAAVHAWHLIGDQ----TLSN--   255
NP_001025856.1     190   LLLTGVACSCAVGVKYMGLFTYMLLLAIAGLHFWHMLGDR----NLSN--   233
NP_001041532.2     185   LVICGVSCAFGIGVKYMGMFTYFLLLSQAAVHTWQLIGDR----TLSH--   228
NP_524025.2        344   GTAAAVCLGAAGTVKYVGFLALGLAFYLLCRHLWQLLYDA----GLTD--   387
XP_318526.4        261   GTIASASLTAAVCVKFVGFYSYLLAMYIIGRHVWMELPDR----RRSN--   304
NP_012677.1        227   LHATGLSLSFVISTKYVGVMTYSAIGFAAVVNLWQLLDIK---AGLSL--   271
XP_451701.1        236   LYLTGFSLSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIR---SGLSM--   280
NP_982862.2        222   LYATGLSLSFVISTKYVGVFTFAMIGTAVIVNLWQLLDVR---AGLSL--   266
NP_596807.1        232   LFFTGFFLSCTISTKYVGFFTFLSIGLSVCLELWYLWDIK---TGLTV--   276
XP_003713520.1     226   LILTGFALSCDISTKYVGVFAFISIGSAVVIDLWDLLDVKRKDGALSL--   273
XP_963926.2        226   LILTGFALSCDISTKYVGLFAFITIGSAVCIDLWDLLDIKRPGGALTL--   273
NP_001006756.1     190   LLLTGISCTFAIGVKYMGLFSYLLILGVAAVHYWQLIGDQ----TLGN--   233


NP_009102.3        236   ADVQCCMRPACMGQMRMSQGVCVFCHLLARAVALLVIPVVLYLLFFYVHL   285
NP_001233574.1     234   --------------------VCVFCHLLARAVALLVIPVVLYLLFFYVHL   263
XP_002799997.1     236   ADVQCCMRQACVGQMGMSQGVCVFCHLLARAVALLVIPVVLYLLFFYVHL   285
XP_849854.1        234   --------------------VCVLCHLLARAAALLVIPTLMYLLFFYVHL   263
NP_001073799.1     234   --------------------VRVLCHLLARAAALVVLPVLVYLLFFYIHL   263
NP_660127.1        256   --------------------MRVLSHLLARIVALLVVPVFLYLLFFYVHL   285
NP_445858.1        256   --------------------ICVLSHLLARAVALLVVPVFLYLLFFYVHL   285
NP_001025856.1     234   --------------------VSLVCHFLARGLTLLVIPGPMYLSFFFVHL   263
NP_001041532.2     229   --------------------GKVMFHVLVRFLALVVLPVIMYLGFFYIHL   258
NP_524025.2        388   --------------------RQLWMHAISRLLIFVGIPLAVYLGVFYIHF   417
XP_318526.4        305   --------------------ASILLKVITKSLLILGVSLAVYIGCFYLHF   334
NP_012677.1        272   --------------------RQFMRHFSKRLNGLVLIPFVIYLFWFWVHF   301
XP_451701.1        281   --------------------RKVVKHTLVRINGLIIFPFVVYLFWFWCHF   310
NP_982862.2        267   --------------------RMFFRHFVQRFNGLVCFPFAVYLFWFYVHF   296
NP_596807.1        277   --------------------ERFFQHFLARFFCLIFFPFLFFLFWFYMHF   306
XP_003713520.1     274   --------------------PIWAKHFSARAFGLIIMPFIFYLFWFQVHF   303
XP_963926.2        274   --------------------PQFGKHFAARAFGLIIMPFIFYLFWFQVHF   303
NP_001006756.1     234   --------------------VWLLFHLLARCLALLLMPVLLYLGIFYLHL   263


NP_009102.3        286   ILVFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGK   335
NP_001233574.1     264   ILVFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGK   313
XP_002799997.1     286   ILLFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGK   335
XP_849854.1        264   ILVYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAYGSQVTLKNVFGK   313
NP_001073799.1     264   LLLCRSGPHDQIMSSAFQASLEGGLARVTQGQPLEVAFGSQVTLKNVFGQ   313
NP_660127.1        286   MLLYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLKSVSGK   335
NP_445858.1        286   MLLYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLKSVSGK   335
NP_001025856.1     264   TLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVAYGSQITLRNVLGK   313
NP_001041532.2     259   TLLYRSGPHDQMMSSAFQASLEGGLARITQGQPLDVAFGSQVTLRTVSGK   308
NP_524025.2        418   KTLHRAGPHDSIMTSAFQASLDGGLASITKGQPLAVVHGSQITLRHTHGR   467
XP_318526.4        335   ATLYKAGPHDNVMTSAFQASLEGGLASITKGQPLRVQHGSQITLKHTHGR   384
NP_012677.1        302   TVLNTSGPGDAFMSAEFQETLKDSPLSV---DSKTVNYFDIITIKH---Q   345
XP_451701.1        311   AILNQSGPGDAFMSSDFQDTLLDAPGAV---EIKSINYHDIITIKH---K   354
NP_982862.2        297   AILTKSGPGDDFMSSAFQETLADSPLAK---DSKDVHYYDIVTFQH---R   340
NP_596807.1        307   NILTISGPGDSFMSLEFQETLSDNPITA---NSTILNYYDIVTIKH---M   350
XP_003713520.1     304   AVLTRSGPGDDFMTPEFQETLSDNVMLA---NAITINYYDTITLRH---K   347
XP_963926.2        304   SILTRSGPGDDFMTPEFQETLSDNIMLA---NAVTIDYYDTISIRH---K   347
NP_001006756.1     264   SILTRSGPHDHIMSSAFQASLEGGLSRITEGQPLEVVYGSQITLKNTLGK   313


NP_009102.3        336   PVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPR-RH   384
NP_001233574.1     314   PVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPR-RH   362
XP_002799997.1     336   PVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG-RH   384
XP_849854.1        314   PVPCWLHSHQSTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG-RH   362
NP_001073799.1     314   PVPCWLHSHQSTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG-RH   362
NP_660127.1        336   PLPCWLHSHKNTYPMIYENGRGSSHQQQVTCYPFKDINNWWIVKDPG-RH   384
NP_445858.1        336   PLPCWLHSHKNTYPMIYENGRGSSHQQQVTCYPFKDINNWWIVKDPG-RH   384
NP_001025856.1     314   PMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG-MQ   362
NP_001041532.2     309   PVPCWLHSHKANYPIRYENGRGSSHQQQVTCYPFKDVNNWWIIKDPG-RQ   357
NP_524025.2        468   --TCWLHSHAAVYPVRYPDKRGSSHQQQVTCYSFKDVNNWWLVKRPT-KE   514
XP_318526.4        385   --VCWLHSHTHVYPIKYKDGRGSSHQQQVTCYGFKDVNNWWIVKRPN-KD   431
NP_012677.1        346   DTDAFLHSHLARYPQRYEDGRISSAGQQVTGYTHPDFNNQWEVLPPH---   392
XP_451701.1        355   ATDAFLHSHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQWEILPPS---   401
NP_982862.2        341   DTGALLHSHNAYYPLRYEDGRVSSQGQQVTGYSHEDINNQWEILPTK---   387
NP_596807.1        351   GTNAFLHSHPEKYPIPYDDGRISSGGQQVTGYQFDDENNYWMILPADHYD   400
XP_003713520.1     348   ETKTYLHSHPDRYPLRYDDGRVSSQGQQVTGYPFNDTNNYWQILPMN---   394
XP_963926.2        348   ETKAYLHSHPDKYPLRYDDGRVSSQGQQVTGYPFNDTNNYWQILPPG---   394
NP_001006756.1     314   PVPCWLHSHKHTYPVRYEGGRGSSHQQQVTCYPYKDVNNWWIVKDPA-RQ   362


NP_009102.3        385   QLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYI--   432
NP_001233574.1     363   QLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYI--   410
XP_002799997.1     385   QLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYI--   432
XP_849854.1        363   QLVVNNPPRPVRHGDVVQLVHGMTTRFLNTHDVAAPLSPHSQEVSCYV--   410
NP_001073799.1     363   QLVVNNPPRPVRHGDVVQLVHGMTTRLLNTHDVAAPLSPHAQEVSCYI--   410
NP_660127.1        385   QLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYI--   432
NP_445858.1        385   QLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYI--   432
NP_001025856.1     363   QLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYI--   410
NP_001041532.2     358   SLVVSSPPRPVRRGDIIQLLHGMTTRYLNTHDVAAPMSPHSQEVSGYI--   405
NP_524025.2        515   NLVVGDEPDIIRHGEIIQLVHGITSRALNSHDVAAAMTPQCQEVSCYI--   562
XP_318526.4        432   SLMVDDEPDYIEHGDVIQLVHGVTSRALNSHDVASPMSPLCQEVSCYI--   479
NP_012677.1        393   -GSDVGKGQAVLLNQHIRLRHVATDTYLLAHDVASPFYPTNEEITTVTLE   441
XP_451701.1        402   -GSKFKKGAPVKLDADIRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEE   450
NP_982862.2        388   -ELSSRTGQPVLLDDVLRLRHIATGTYLLTHDVASPYYPTNEEVTTISEE   436
NP_596807.1        401   PPIEAKLNVPVKNMDYIKLHHVGTNTDLMTHDVASPYHPTNEEFTTVSVD   450
XP_003713520.1     395   --DDKQEGRVVRHQELVRLRHLGTDTILLSHDVASPYYPTNQEFTTCSLT   442
XP_963926.2        395   -PDDQKLGHPIKNHDLVRLRHIVTDTILLSHDVASPYYPTNQEFTTVSIG   443
NP_001006756.1     363   QMVVDSPPRPIRHGDTVQLLHGMSARFLNTHDVAAPFSPYSQEVSCYI--   410


NP_009102.3        433   DYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAH   482
NP_001233574.1     411   DYNISMPAQNLWRLEIVNRGSDTDVWKSILSEVRFVHVNTSAVLKLSGAH   460
XP_002799997.1     433   DYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAH   482
XP_849854.1        411   DYNISMPSQNLWRLDIVNRESDTEVWKTILSEVRLVHVNTSAVLKLSGAH   460
NP_001073799.1     411   DYNISMPPQNLWRLDIVNRESDTDVWKTILSEVRFVHVNTSAILKLSGVP   460
NP_660127.1        433   DYNISMPAQNLWKLDIVNRESNRDTWKTILSEVRFVHVNTSAILKLSGAH   482
NP_445858.1        433   DYNISMPAQNLWKLDIVNRESNQDTWKTILSEVRFVHVNTSAILKLSGAH   482
NP_001025856.1     411   DYNISMPAQNLWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKLSGAS   460
NP_001041532.2     406   DFNVSMPAQNLWRVDIVNRESEKEIWKTILSEVRLVHVNTSAVLKLSGAS   455
NP_524025.2        563   DYEIKMAGELLWRVEILNRDSEGDIWHAIKSEVRLVHVSTEASLKFSGRQ   612
XP_318526.4        480   DYNISMPANLLWRVELLNGKESKNKWHAITSQVRLVHVNTTAALKYTGEQ   529
NP_012677.1        442   EGDGELYPETLFAFQPLKKSDEGHVLKSKTVSFRLFHVDTSVALWTHNDE   491
XP_451701.1        451   EANGESYDFTLFRFQPILPKNSGRVAKTKNSAFRIFHVQTAVALWTHNDK   500
NP_982862.2        437   LANGERYKQTLFKLQPPNKKDGGHTVKSKTSMFRMFHVDTAVALWTHNDV   486
NP_596807.1        451   ESAGKKHEYTLFQVVMSDNTDPQRPLYTKASSFKLIHKLTHVAMWSDPKP   500
XP_003713520.1     443   DAYGDRAKDTLFEVR-FENGKPGQEFKSIASHFKLIHNPSKVAMWTHTTP   491
XP_963926.2        444   DAYGDRAADTLFEIR-IEHGKANQEFKSISSHFKLIHNPSKVAMWTHSKP   492
NP_001006756.1     411   DYNISMPAQSLWKVEIVNRESDMDTWKTIISEVKLIHVNTSAALKLSGTA   460


NP_009102.3        483   -LPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSP   531
NP_001233574.1     461   -LPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSP   509
XP_002799997.1     483   -LPDWGYRQLEIVGEKLSRGYHESMVWNVEEHRYGASQEQRERERELHSP   531
XP_849854.1        461   -LPDWGFQQLEVVGEKLSRGYHESMVWNVEEHRYGKSQEQKERELELHSP   509
NP_001073799.1     461   -LPDWGFRQLEVVGEKLFRGYHESTVWNVEEHRYGRSQEQKERELELHSP   509
NP_660127.1        483   -LPDWGFRQLEVVGEKLSPGYHESMVWNVEEHRYGKSHEQKERELELHSP   531
NP_445858.1        483   -LPDWGFRQLEVVGEKLSLGPHESMVWNVEEHRYGRGHEQKERELELHSP   531
NP_001025856.1     461   -LPEWGYRQLEVVGEKLSKGYHQSMVWNVEEHRYGKSQEQKEREVELHSP   509
NP_001041532.2     456   -LPEWGFKQLEVVGDKIYKGYQQTGMWNVEEHRYGRSQEPKERELELKSP   504
NP_524025.2        613   -LPEWGFNQHEVVADR-EKAIHEDAIWNVEEHRYTQTEDHRERERQMLTA   660
XP_318526.4        530   -LPDWGYNQFEVAADR-RQQTI-DTIWNVEEHRYTQHKDKKDVLNKLLAT   576
NP_012677.1        492   LLPDWGFQQQEINGNK--KVIDPSNNWVVDEIVNL--DEVRKVYIPKVVK   537
XP_451701.1        501   LLPEWGFSQQEVNGNK--KVQDPENNWFVDSIVNMPENDSRRIYTPKVPT   548
NP_982862.2        487   FLPEWGFKQQEVNGNK--KVTDPANIWTVNSILNL--SEERKVYIPKKVT   532
NP_596807.1        501   -LPDWAFKQLEINGAK--NIQTGSIFWTFDDIIGL--KDSRLKKEKKIPK   545
XP_003713520.1     492   -LPEWGHKQQEINGNK--QVTVSSNVWFVEDIPSLEADHPRRAKVEKKVR   538
XP_963926.2        493   -LPEWGHKQQEINGNK--QLAQSSNVWLVEDIVSLPADHARREKPEKKVK   539
NP_001006756.1     461   -LPDWGFRQLEVVGDKASKSYHQSLVWNVEEHRYGRSQEQSEREQELHTS   509


NP_009102.3        532   AQVDVSRN-LSFMARFSELQWRMLALRSD-DSEHKYSSSPLEWVTLDTNI   579
NP_001233574.1     510   AQVDVTRN-LSFMARFSELQWRMLALRSD-DSEHKYSSSPLEWVTLDTNI   557
XP_002799997.1     532   AQVDVSRN-LSFMARFLELQWKMLVLRSD-DSEHKYSSSPLEWVTLDTNI   579
XP_849854.1        510   AQMDVSRN-LSFMARFLELQWRMLTAKSD-DSEHKYSSSPLDWVTLDTSI   557
NP_001073799.1     510   TQVDISRN-LSFMARFSELQWRMLTVRSD-DSEHKYSSTPLDWVMLDTNI   557
NP_660127.1        532   TQLDISRN-LSFMARFSELQWKMLTLKNE-DLEHQYSSTPLEWLTLDTNI   579
NP_445858.1        532   TQHDISRN-LSFMARFSELQWKMLTLKNE-DLEHQYSSTPLEWLTLDTNI   579
NP_001025856.1     510   TRMDIGKN-LSFMAKFTELQWKILTLKNE-DTEHKYSSSALDWITMDTNI   557
NP_001041532.2     505   THSDVNKN-LTFMAKFLELQWKMLTVKNE-ESEHKYSSSPLEWITMDTNI   552
NP_524025.2        661   EMIPTKRTRISFWAKLLELQSKMLFQTKS-VPNHMYSSMPHEWPLMDKGI   709
XP_318526.4        577   EMIPTEPTKLSFWNKFSELQLKMLLHADK-LESHMYSSEPHEWPLMDKGI   625
NP_012677.1        538   P--------LPFLKKWIETQKSMFEHNNKLSSEHPFASEPYSWPGSLSGV   579
XP_451701.1        549   S--------MPFFQKWYELQFLMFEHNNKLSSEHPFASNPQSWPLSLSGV   590
NP_982862.2        533   K--------MPFFSKWLELQRSMFEHNNKLSSEHPFASQPESWPGSLSGV   574
NP_596807.1        546   K--------LPFWKKYLELQLTMFRQNNMLTEFHPYSSNPSDWFTLHHGI   587
XP_003713520.1     539   H--------MPFIQKWFELQRSMFWHNSRLTSSHPYASLPYQWPFLLRGV   580
XP_963926.2        540   T--------LPFLRKWFELQRSMFWHNNQLTSSHPYASLPYQWPFLLRGV   581
NP_001006756.1     510   PHIDVGRN-LSFMSRFWELQWKMLTMRTE-SSEHKYSSYPMDWITMDTSI   557


NP_009102.3        580   AYWLHPRTSAQIHLLGNIVIWVSGSLALAIYALLSLWYLLRRRRNVHDLP   629
NP_001233574.1     558   AYWLHPRTSAQIHLLGNIVIWVSGSLALAIYALLSLWYLLRRRRNVHDLP   607
XP_002799997.1     580   AYWLHPRTSAQIHLLGNIVIWISGSLALAIYALLSLWYLLRQRRNVHDLP   629
XP_849854.1        558   AYWLHPRTSAQIHLLGNIVIWASASLAMVVYVLLFFWYLLRRRRSICDIP   607
NP_001073799.1     558   AYWLHPRTSAQIHLLGNVVIWASASLATLVYALLFIWYLLRRRRRVCDLP   607
NP_660127.1        580   AYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRRRSICDLP   629
NP_445858.1        580   AYWLHPRTSAQIHLLGNIVIWTSASLATVAYTLLFFWYLLRRRRNICDLP   629
NP_001025856.1     558   AYWLHPTSGAQIHLLGNVCTWASANIAAVVYTCLSLWYLIRRRRKIYDIP   607
NP_001041532.2     553   AYWLHPSSNAQIHFIGNIVTWTTGNITLVVYCLLFLTYLIRRRRKVEDIP   602
NP_524025.2        710   AYWLDSQSSAQIYLLGNILLWYTATMGILVYAGLLAFYAMRRQRLCFDIS   759
XP_318526.4        626   AYWIDGDSNAQVHLLGNLVIWYSATMAIVLYVAFLVFYLIRRRREIYDLE   675
NP_012677.1        580   SFWTNGDEKKQIYFIGNIIGWWFQVISLAVFVGIIVADLITRHRGYYALN   629
XP_451701.1        591   SFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVADLITRQRAVYALN   640
NP_982862.2        575   SFWTNDTERRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLG   624
NP_596807.1        588   AFWAKSEENKQIYLLGNPIGWWIIAGTVLSTTVVAAAEILLRQRGIRTLP   637
XP_003713520.1     581   SFWTQNDTRQQIYFLGNPIGWWLASSLLAVYIGILAADQFSLRRGVDALD   630
XP_963926.2        582   SFWTQNDTRQQIYFLGNPIGWWLASSVLAIYAGIILADQFSLRRGLDAMD   631
NP_001006756.1     558   AYWLHPKSTAQIQLLGNPVIWNSANLGALIYSALLIFYLLRQRRRIYDIP   607


NP_009102.3        630   QDAWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPV   679
NP_001233574.1     608   QDAWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPV   657
XP_002799997.1     630   QDAWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPV   679
XP_849854.1        608   EDSWLRWVLAGALCAGGWAVNYLPFFMMEKTLFLYHYLPALTFQILLLPV   657
NP_001073799.1     608   EDRWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPV   657
NP_660127.1        630   EDAWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPI   679
NP_445858.1        630   EDAWSHWVLAGALCIGGWALNYLPFFLMERMLFLYHYLPALTFQILLLPI   679
NP_001025856.1     608   EDAWQLWVSAGQICVGGWVVNYLPFFLMEKTLFLYHYLPALTFQILLIPI   657
NP_001041532.2     603   QDSWEQLVLAGVVCFGGWAVNYLPFFLMEKTLFLYHYLPALTFKILQIPI   652
NP_524025.2        760   EQEWQRFVLAGDTFFMGYVMHYIPYFCVDRTLFLHNYLPAFVFKLLLLCF   809
XP_318526.4        676   PVEWDRFRLGGEIFLAGYLIHYLPYFFMERTLFLYNYLPALLFKVMLLCF   725
NP_012677.1        630   KMTREKLYGPLMFFFVSWCCHYFPFFLMARQKFLHHYLPAHLIACLFSGA   679
XP_451701.1        641   KMARQKLYGPMAFLIFGWCIHYFPFFLMARQKFLHHYLPAHLILAMFSAA   690
NP_982862.2        625   KLAREKIYGPLCFLYIGWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAG   674
NP_596807.1        638   ETVRNHFYRSTMFFYMTYVFHYLPFFIMGRQLFLHHYLPAHLAGSLLVGA   687
XP_003713520.1     631   HRSRSRLYNSTGFFFLSWLTHYVPFYVMGRQLFLHHYLPSHLASCLVAGA   680
XP_963926.2        632   RRTRSRLYNSTGFFFLAWATHYFPFFVMGRQLFLHHYLPAHLASALVTGS   681
NP_001006756.1     608   QGSWEALQLTGVLFLGGWAVNYLPFFLMEKTLFLYHYLPALTCQILLLPP   657


NP_009102.3        680   VLQHI------------------------------SDHLC-----RSQLQ   694
NP_001233574.1     658   VLQHI------------------------------SDHLC-----RSQLQ   672
XP_002799997.1     680   VLQHI------------------------------SDHLC-----RSQLQ   694
XP_849854.1        658   VLQHV------------------------------SDHLC-----RSQLL   672
NP_001073799.1     658   VLEHI------------------------------SDHLC-----RSQLQ   672
NP_660127.1        680   VLQHA------------------------------SDHLC-----RSQLQ   694
NP_445858.1        680   VMQHA------------------------------SDHLC-----RSQLQ   694
NP_001025856.1     658   VLQHL------------------------------SDHLC-----RSLLS   672
NP_001041532.2     653   VTEHL------------------------------YIHVL-----RSSAQ   667
NP_524025.2        810   VVEHL------------------------------DYLLRRFCTGRGVHL   829
XP_318526.4        726   VVDHC------------------------------QLALRKFVK-QSTLV   744
NP_012677.1        680   LWEVIFSDC-------------KSLDLEKDEDISGASYER-----NPKVY   711
XP_451701.1        691   LWEIVFTDN-------------QSLDFDLDEEDSKNPHDA-----EPKVY   722
NP_982862.2        675   LWEVIFTDN-------------RALTTRKDESEPAAPHNT-----NPIVY   706
NP_596807.1        688   FIQLACRKSFRSP---------VSAGVPIPKDVDEKGHSK-----CHRKY   723
XP_003713520.1     681   LIEFICNSDPMDGDDVPATGGKKAVAVKPKRHITAAERFA-----GKSLM   725
XP_963926.2        682   VVEFLFSTDSAEPEYQPSKSGKK-VAPTTKRRLSARERLA-----GQSMA   725
NP_001006756.1     658   LLEHL------------------------------HQHLL-----RSEAL   672


NP_009102.3        695   RSIFSALVVAWYS-SACHVSNTLRPLTYGDKSLSPHELKALRWKDSWDIL   743
NP_001233574.1     673   RSVFSALVVAWYS-SACHVSNTLRPLTYGDKSLSPHELKALRWKDSWDIL   721
XP_002799997.1     695   RSVFSALVVAWYS-SACHVSHTLRPLTYGDKSLSPHELKALRWKDSWDIL   743
XP_849854.1        673   RSLFSALVVAWYS-CACHVFNTLRPLTYGDKSLSPSELKALRWKDSWDIL   721
NP_001073799.1     673   RSLFTALVVAWFT-SACHVSNMLRPLTYGDRSLSPSELKALRWKDSWDIL   721
NP_660127.1        695   RNVFSALVVAWYS-SACHVSNMLRPLTYGDTSLSPGELRALRWKDSWDIL   743
NP_445858.1        695   RNVFSALVVAWYS-SACHVSNMLRPLTYGDTSLSPGELRALRWKDSWDIL   743
NP_001025856.1     673   KSMFNALIVAWFS-SVCFAYRTFSPVTYGE-PLSVAELKDLRWKDSWNIL   720
NP_001041532.2     668   QKAFGGVILAVLC-SVYMSYHSLSPLTYGQPALTSDKLAELRWRESWDIL   716
NP_524025.2        830   VRLYRLMLILWLV-GVLSIFSKFIPFSYGARKMTLNEVRSLRWKDTWDFV   878
XP_318526.4        745   IGIFRAIVVAWFS-GVLYFFQRYSVLSYGTTALSADDVLELRLKDTWDLI   793
NP_012677.1        712   VKPYTVFLVCVSC-AVAWFFVYFSPLVYGDVSLSPSEVVSREWFD-IELN   759
XP_451701.1        723   TIAYYLFCLSVIV-NVGGCFIYFAPLVYG-LSMTVDQIKARQWFD-IKLQ   769
NP_982862.2        707   EYFLLAFLGLLSI-AVVGFFIYFSPIVYGDRTLTPEEVIKRQWFD-IKLH   754
NP_596807.1        724   GHVIELICTLLLIFVVIYCFTFFAPMTYGDKSLSVDEWTRRKWLDSWVFQ   773
XP_003713520.1     726   VTWAVCMGILAIV-IAGWYF--FLPLTYGYPGLSVDQVLRRKWLG-YDLH   771
XP_963926.2        726   GAWIATAVIMVLV-AFGWYF--FLPLTYGYPGLTAPEVNRRKWLG-YDLH   771
NP_001006756.1     673   QNTFAALLLVWGC-SVYLTYRKICPLTYGDPPLSPAELRSLRWKDNWDIL   721


NP_009102.3        744   IRKH----   747
NP_001233574.1     722   IRKH----   725
XP_002799997.1     744   IRKH----   747
XP_849854.1        722   IRKH----   725
NP_001073799.1     722   IRKY----   725
NP_660127.1        744   IRK-----   746
NP_445858.1        744   IRKY----   747
NP_001025856.1     721   IRKQ----   724
NP_001041532.2     717   LRKR----   720
NP_524025.2        879   LHKNHHLY   886
XP_318526.4        794   VHKP----   797
NP_012677.1        760   FSK-----   762
XP_451701.1        770   FAK-----   772
NP_982862.2        755   FAK-----   757
NP_596807.1        774   YQKQN---   778
XP_003713520.1     772   FAK-----   774
XP_963926.2        772   FAK-----   774
NP_001006756.1     722   IRKQ----   725


Protein Acc. Gene Organism
NP_009102.3 POMT1 H.sapiens
NP_001233574.1 POMT1 P.troglodytes
XP_002799997.1 POMT1 M.mulatta
XP_849854.1 POMT1 C.lupus
NP_001073799.1 POMT1 B.taurus
NP_660127.1 Pomt1 M.musculus
NP_445858.1 Pomt1 R.norvegicus
NP_001025856.1 POMT1 G.gallus
NP_001041532.2 pomt1 D.rerio
NP_524025.2 rt D.melanogaster
XP_318526.4 AgaP_AGAP010784 A.gambiae
NP_012677.1 PMT4 S.cerevisiae
XP_451701.1 KLLA0B03762g K.lactis
NP_982862.2 AGOS_ABL085W E.gossypii
NP_596807.1 ogm4 S.pombe
XP_003713520.1 MGG_04427 M.oryzae
XP_963926.2 NCU09332 N.crassa
NP_001006756.1 pomt1 X.tropicalis


Support Center