Display Settings:

Format

Send to:

Choose Destination
HomoloGene:68498. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_006000.2          1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50
NP_001092014.1       1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50
XP_001108924.2       1   -----------------------------------MPSDKTIGGGDDSFN   15
XP_862471.2          1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50
NP_001159977.1       1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50
NP_035783.1          1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50
NP_071634.1          1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50
XP_419249.3          1   -----------------------------------MPSDKTIGGGDDSFN   15
NP_001177911.1       1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50
NP_492268.1          1   MREIVSIHIGQAGVQIGNACWELYCLEHGITPDGLMPDDTSYGVEDQSYN   50
XP_002935154.1       1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN   50


NP_006000.2         51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100
NP_001092014.1      51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100
XP_001108924.2      16   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   65
XP_862471.2         51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100
NP_001159977.1      51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100
NP_035783.1         51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100
NP_071634.1         51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100
XP_419249.3         16   TFFSETGAGKHVPRAVFVDLEPAVIDEVRNGTYRQLFHPEQLISGKEDAA   65
NP_001177911.1      51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100
NP_492268.1         51   TFFSETPSGKHVPRAIFVDLEPTVIDEVRTGTYAKLFHPEQLISGKEDAA   100
XP_002935154.1      51   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA   100


NP_006000.2        101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150
NP_001092014.1     101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150
XP_001108924.2      66   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   115
XP_862471.2        101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150
NP_001159977.1     101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150
NP_035783.1        101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150
NP_071634.1        101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150
XP_419249.3         66   NNYARGHYTVGKEIIDLVLERIRKLSDQCTGLQGFLIFHSFGGGTGSGFT   115
NP_001177911.1     101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150
NP_492268.1        101   NNYARGHYTIGKELIDVVMDRVRRLTERCQSLQGFLIFHSFGGGTGSGFT   150
XP_002935154.1     101   NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT   150


NP_006000.2        151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200
NP_001092014.1     151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200
XP_001108924.2     116   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   165
XP_862471.2        151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200
NP_001159977.1     151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200
NP_035783.1        151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200
NP_071634.1        151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200
XP_419249.3        116   SLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   165
NP_001177911.1     151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200
NP_492268.1        151   SLVMERLSIDYGKKAKLEFSIYPAPQISTSMVEPYNSLLTTHTTLEHSDC   200
XP_002935154.1     151   SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC   200


NP_006000.2        201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250
NP_001092014.1     201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250
XP_001108924.2     166   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   215
XP_862471.2        201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250
NP_001159977.1     201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250
NP_035783.1        201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250
NP_071634.1        201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250
XP_419249.3        166   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   215
NP_001177911.1     201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250
NP_492268.1        201   SFIMDNEAIYEITKVNLGVRSPTYTHLNRLLAQVVSSITASLRFDGALNV   250
XP_002935154.1     201   AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV   250


NP_006000.2        251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300
NP_001092014.1     251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300
XP_001108924.2     216   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   265
XP_862471.2        251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300
NP_001159977.1     251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300
NP_035783.1        251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300
NP_071634.1        251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300
XP_419249.3        216   DLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITNACFEPSN   265
NP_001177911.1     251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300
NP_492268.1        251   DLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVSEITNVCFEPGS   300
XP_002935154.1     251   DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN   300


NP_006000.2        301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350
NP_001092014.1     301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350
XP_001108924.2     266   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   315
XP_862471.2        301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350
NP_001159977.1     301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350
NP_035783.1        301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350
NP_071634.1        301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350
XP_419249.3        266   QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTG   315
NP_001177911.1     301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350
NP_492268.1        301   QMVKCDPRNGKYMACCLLYRGDVVPKEINSAISTIKTKRAIQFVDWCPTG   350
XP_002935154.1     301   QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG   350


NP_006000.2        351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400
NP_001092014.1     351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400
XP_001108924.2     316   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   365
XP_862471.2        351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400
NP_001159977.1     351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400
NP_035783.1        351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400
NP_071634.1        351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400
XP_419249.3        316   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   365
NP_001177911.1     351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400
NP_492268.1        351   FKVGINYQPPTVVPGGDMAKLQRAVCMLSNTTAIQEAWARLDHKFDLMYA   400
XP_002935154.1     351   FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA   400


NP_006000.2        401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   450
NP_001092014.1     401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   450
XP_001108924.2     366   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   415
XP_862471.2        401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   450
NP_001159977.1     401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   450
NP_035783.1        401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   450
NP_071634.1        401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   450
XP_419249.3        366   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSM--DGEDEGEE   413
NP_001177911.1     401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSIEGEGEEEGEE   450
NP_492268.1        401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSF----DPNDEE   446
XP_002935154.1     401   KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE   450


NP_006000.2        451   Y   451
NP_001092014.1     451   Y   451
XP_001108924.2     416   Y   416
XP_862471.2        451   Y   451
NP_001159977.1     451   Y   451
NP_035783.1        451   Y   451
NP_071634.1        451   Y   451
XP_419249.3        414   Y   414
NP_001177911.1     451   Y   451
NP_492268.1        447   Y   447
XP_002935154.1     451   Y   451


Protein Acc. Gene Organism
NP_006000.2 TUBA1A H.sapiens
NP_001092014.1 TUBA1A P.troglodytes
XP_001108924.2 TUBA1A M.mulatta
XP_862471.2 TUBA1A C.lupus
NP_001159977.1 TUBA1A B.taurus
NP_035783.1 Tuba1a M.musculus
NP_071634.1 Tuba1a R.norvegicus
XP_419249.3 TUBA3E G.gallus
NP_001177911.1 tuba1l2 D.rerio
NP_492268.1 tba-5 C.elegans
XP_002935154.1 tuba1b X.tropicalis


Support Center