Display Settings:

Format

Send to:

Choose Destination
HomoloGene:6337. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_612211.1          1   MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFD   50
XP_001169430.2       1   MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFD   50
XP_001105258.1       1   MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFD   50
XP_849136.1          1   MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYSVGLCICLFD   50
NP_001070430.1       1   MFVLVEMVDTVRIPPWQFERKLNDSIDEELNKKLANKVMYNVGLCICLFD   50
NP_084505.2          1   MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFD   50
NP_001120767.1       1   MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFD   50
NP_001264303.1       1   MFVLVEMTDTVRIPPWQFERKLNESIAEELNKKLANKVVYNVGLCICLYD   50
NP_001002476.1       1   MFVLVEMRDTVRIPPWSFQRPLNEAVAEELNKKLANKVVYNVGLCICLYD   50
NP_001261720.1       1   MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKD   50
XP_320407.3          1   MFVLAELKDNVRIAPELFGLKLPEAIKDEINRKLANKVLLNVGLCIALKD   50
NP_505625.1          1   MFILSLLHDTVAIQPHQLSSDQQIVIKKRLNERLANKIIPDLGLCICVYD   50
NP_012778.1          1   MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYD   50
XP_454570.1          1   MFILTKVADLVRIPPDQFKRDTISTIVHELNTKYANKIIPHIGLCVTVYD   50
NP_983452.1          1   MFILTKISDLVRIPPDQFHRDTASAINHQLNNKYANKIIPHVGLCITIYD   50
NP_596068.1          1   MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYD   50
XP_003713434.1       1   MFILTKIADLVQIKPAQFAKLSIDAIEDNLNEKYCNKVIQKVGLCICMYD   50
NP_172164.1          1   MFYLSELEHSLRVPPHLLNLPLEDAIKSVLQNVFLDKVLADLGLCVSIYD   50
NP_001059628.1       1   MFVLSQIEHNLPMPPHLLSRPLVDAIKAELERLFLDKVVANLGLCVSVYD   50
NP_001072397.1       1   MFVLVEMVDTVRTNPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFD   50


NP_612211.1         51   ITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVS   100
XP_001169430.2      51   ITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVS   100
XP_001105258.1      51   ITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVS   100
XP_849136.1         51   ITRLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGRIKGCSPEGVHVS   100
NP_001070430.1      51   ITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVS   100
NP_084505.2         51   ITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVS   100
NP_001120767.1      51   ITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVS   100
NP_001264303.1      51   ITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILVGEIKSCSQDGVHVS   100
NP_001002476.1      51   ITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILLGKIKGCSAEGVHVS   100
NP_001261720.1      51   IVSLKDSIILPGDGASHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVT   100
XP_320407.3         51   IVKLGDSIILPGDGASHTEVNFRYIVFRPMIGDVITGKIRSCSREGVHIT   100
NP_505625.1         51   INEIGDSYILPGEGDCRARVKFRMIVFRPFVDEVIEAKVIGSSRQGLCLT   100
NP_012778.1         51   LLTVEEGQLKPGDGSSYINVTFRAVVFKPFLGEIVTGWISKCTAEGIKVS   100
XP_454570.1         51   VLDVDEGQLKPGDGAAFINVTFRALVFKPFVGEIVTGWISQCTTEGIKVS   100
NP_983452.1         51   LLTVDEGQLKPGDGASFINVTFRALVFKPFVGEIITGWITQCTNEGIKVS   100
NP_596068.1         51   FLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVT   100
XP_003713434.1      51   LLWASEGLIGHGDGLVNVNVECRLVIFRPFKGEVLFGRISRCVKDGIHLR   100
NP_172164.1         51   IKSVEGGFVLPGDGAATYKVGLRIVVFRPFVGEVIAAKFKESDANGLRLT   100
NP_001059628.1      51   IRSVEGGFIFPGEGCSTYKVSFRLLMFRPFVGEVLVGKISGYDEKGLHVS   100
NP_001072397.1      51   ITKMDDSYIFPGDGASHTKVQFRYVVFRPFLDEILMGKIKGCSPEGVHVS   100


NP_612211.1        101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
XP_001169430.2     101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
XP_001105258.1     101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
XP_849136.1        101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
NP_001070430.1     101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
NP_084505.2        101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
NP_001120767.1     101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
NP_001264303.1     101   -IGFFDDIVIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139
NP_001002476.1     101   -LGFFDDILIPPESLQQPA-----KFDEAEQV---WVWEYETDEGT--HD   139
NP_001261720.1     101   -LGFFDDILIPHAALQHPS-----RFDEAEQA---WVWEYPLEDGAK-HD   140
XP_320407.3        101   -LGFFDDILIPPSALQHPS-----RYEEAEQA---WVWEYPLEDGNT-HD   140
NP_505625.1        101   -IQFFEDIFVPAEKLPEPH-----VFEEEGQV---WYWEYAQEDGEPPAK   141
NP_012778.1        101   LLGIFDDIFIPQNMLFEGC-----YYTPEESA---WIWPMDEE-----TK   137
XP_454570.1        101   LLGLFEDIFVPQNMLFEGS-----YFSPKENA---WIWPMDDE-----TK   137
NP_983452.1        101   LLGMFDDIFIPAKMLFEGS-----YYSVDDSA---WVWQMDEE-----TK   137
NP_596068.1        101   -ISFFDDIFIPKDMLFDPC-----VFRPDERA---WVWKIEGEDGSEGTE   141
XP_003713434.1     101   -TDFFDDIFVPFDELPEGA-----TFDHDQSL---WVWHVED------QE   135
NP_172164.1        101   -LGFFDDIYVPAPLMPKPNRCEPDPYNRKQMI---WVWEYGEP-----KE   141
NP_001059628.1     101   -LDFFSDISIPGHLM---------QYGTARALDGRWMLKTEDG-----DE   135
NP_001072397.1     101   -LGFFDDIVIPPESLQQPA-----KFDEAEQV---WVWEYETEEGA--HD   139


NP_612211.1        140   LYMDTGE--EIRFRVVDESFVDTSPTGPSS--------ADATTS-S---E   175
XP_001169430.2     140   LYMDTGE--EIRFRVVDESFVDTSPTGPSS--------ADATTS-S---E   175
XP_001105258.1     140   LYMDTGE--EIRFRVVDESFVDTSPTGPSS--------ADATTS-S---E   175
XP_849136.1        140   LYMDTGE--EIRFRVVDESFVDTSPTGPSS--------AEATSS-S---E   175
NP_001070430.1     140   LYMDIGE--EVRFRVVDESFVDTSPTGPSS--------AEAASS-S---E   175
NP_084505.2        140   LYMDTGE--EIRFRVVDESFVDTSPTGPSS--------AEAASS-S---E   175
NP_001120767.1     140   LYMDTGE--EIRFRVVDESFVDTSPTGPSS--------AEAASS-S---E   175
NP_001264303.1     140   LYMDIGE--EIRFRVVDETFVDTSPTGPSS--------AEASTS-NAT-E   177
NP_001002476.1     140   LYMDQGE--EIRFRVTDEVFVDTSPSGPSADKEAPGTGAAAAPP-AGAED   186
NP_001261720.1     141   LFMDVGE--PIKFRVSREIFEETSPIGPPKTEA-QTQQGASTSA-AVASA   186
XP_320407.3        141   LYMDIGE--NIKFRVSGEVFEESSPIGPPDQEVPSSSTGASTSG-GAGSS   187
NP_505625.1        142   LYMDPGK--IVRFRVTEIIFKDLKP---------------------ELTH   168
NP_012778.1        138   LYFDVNE--KIRFRIEREVFVDVKPKSPKERELEERAQLENEIEGKNEET   185
XP_454570.1        138   LYFDVNE--KIRFRVEQEVFVDVKPKSPKEKELEDQLRAKQEL--TEEEK   183
NP_983452.1        138   LYFDVNE--KIRFRVEQEVFVDVKPKSPREQELEEQLKEKDTL--TEEEK   183
NP_596068.1        142   LYFDIDE--EIRFQIESEDFVDISPKRNKNAT-------------AITGT   176
XP_003713434.1     136   MYYDIHE--MVRFRVSSEEWQDQTPTKP------------------IEGS   165
NP_172164.1        142   DYI-VDDACQIKFRVESISYPSV----------------------PTERA   168
NP_001059628.1     136   LYLDLDD--EIRFLVSSIKYPPI----------------------PVEQK   161
NP_001072397.1     140   LYMDVGE--DIRFRMVDETFIDTSPTGPSS--------AEASSS-TAVAE   178


NP_612211.1        176   ELPKKEAPYTLVGSISEPGLGLLSWWTSN---------------------   204
XP_001169430.2     176   ELPKKEAPYTLVGSISEPGLGLLSWWTSN---------------------   204
XP_001105258.1     176   ELPKKEAPYTLVGSISEPGLGLLSWWTSN---------------------   204
XP_849136.1        176   ELPKKEAPYTLVGSISEPGLGLLSWWTSS---------------------   204
NP_001070430.1     176   ELPKKEAPYTLMGSISEPGLGLLSWWTSS---------------------   204
NP_084505.2        176   ELPKKEAPYTLVGSISEPGLGLLSWWTSN---------------------   204
NP_001120767.1     176   ELPKKEAPYTLVGSISEPGLGLLSWWTSN---------------------   204
NP_001264303.1     178   EVQKKEAPYTLVGSISEPGLGLLSWWTNS---------------------   206
NP_001002476.1     187   AAQQKESPYTLIGSVSEPGLGLLSWWNN----------------------   214
NP_001261720.1     187   TSQEVKTPYRIIGAINESGLGVLSWWDQQGKDDEQDDEEDEEYDDEDGE-   235
XP_320407.3        188   GQESNKTPYRIVAAINESGLGLLSWWVQQAQEEDEEGGEEEEQEEEEQEQ   237
NP_505625.1        169   EERKTEKSMEIKGTMASTGLGCIGWWAAEDEDDEAVEDEQDEQEEVIQPK   218
NP_012778.1        186   PQNEKPPAYALLGSCQTDGMGLVSWWE-----------------------   212
XP_454570.1        184   RILEKPPAYALLGSCQTDGTGLVSWWE-----------------------   210
NP_983452.1        184   RLVEKPPAYALLGSCQTDGMGLVSWWE-----------------------   210
NP_596068.1        177   EALESVSPYTLIASCSRDGLGIPAWWK-----------------------   203
XP_003713434.1     166   ELPEKKPPYRITGTMKEEGLGVCLWWGDDGGGVVEEEKVENGDMEVDE--   213
NP_172164.1        169   EDAKPFAPMVVTGNMDDDGLGPVSWWDSYE-----QVDQEE---------   204
NP_001059628.1     162   ETDRAFAPMQIIGSIKGDGLGLLAWWAADEEEGEAEAEAEE---------   202
NP_001072397.1     179   ETPRKEAPYTLVGSISEPGLGLLSWWTNN---------------------   207


NP_612211.1              ---------------------
XP_001169430.2           ---------------------
XP_001105258.1           ---------------------
XP_849136.1              ---------------------
NP_001070430.1           ---------------------
NP_084505.2              ---------------------
NP_001120767.1           ---------------------
NP_001264303.1           ---------------------
NP_001002476.1           ---------------------
NP_001261720.1     236   --GACEE--------------   240
XP_320407.3        238   DSGGENE--------------   244
NP_505625.1        219   EEIRQPQEEVRQPVKIKEEPV   239
NP_012778.1              ---------------------
XP_454570.1              ---------------------
NP_983452.1              ---------------------
NP_596068.1              ---------------------
XP_003713434.1           ---------------------
NP_172164.1              ---------------------
NP_001059628.1           ---------------------
NP_001072397.1           ---------------------


Protein Acc. Gene Organism
NP_612211.1 POLR3H H.sapiens
XP_001169430.2 POLR3H P.troglodytes
XP_001105258.1 POLR3H M.mulatta
XP_849136.1 POLR3H C.lupus
NP_001070430.1 POLR3H B.taurus
NP_084505.2 Polr3h M.musculus
NP_001120767.1 Polr3h R.norvegicus
NP_001264303.1 POLR3H G.gallus
NP_001002476.1 polr3h D.rerio
NP_001261720.1 CG7339 D.melanogaster
XP_320407.3 AgaP_AGAP012122 A.gambiae
NP_505625.1 ZK856.10 C.elegans
NP_012778.1 RPC25 S.cerevisiae
XP_454570.1 KLLA0E13751g K.lactis
NP_983452.1 AGOS_ACR049W E.gossypii
NP_596068.1 rpc25 S.pombe
XP_003713434.1 MGG_10830 M.oryzae
NP_172164.1 AT1G06790 A.thaliana
NP_001059628.1 Os07g0477000 O.sativa
NP_001072397.1 polr3h X.tropicalis


Support Center