Display Settings:

Format

Send to:

Choose Destination
HomoloGene:6044. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_054828.2          1   MVVLRSSLELHNHS-AASATGS--LDLSSDFLSLE-H-IGRRR--LRSAG   43
XP_001148894.1       1   MVVLRSSLELHNHS-AASATDS--LDLSSDFLSLE-Q-IGRRR--LRSAG   43
XP_002808533.1       1   MVVLRSSLELHNHS-AASATDS--LDLSNEFLSLE-Q-IGRRR--LRSAG   43
XP_850520.1          1   MVVLRSSLELHGPL-VSSATDP--LDLSNEFLSLE-Q-IGRRR--LRSAR   43
NP_081711.2          1   MVVLRSSLELHSRSTTSSATDS--LDLSSEFLSLQ-D-SGGRR--PRLRR   44
NP_001128351.1       1   MVVLRSSLELHSHSTISSATDS--LDLSSEFLSLE-H-SGRRR--PSLAR   44
XP_418453.4          1   MVVLRSS---GARRGPPFAI----MDSSSEFISLQPTALGSRRTWTRSQS   43
XP_003200296.2       1   MVMLRSNGD---------------MDSSSEFLSLNP---------PKRKS   26
XP_002941445.2       1   MVLLRSSTGTANGAGPSYREQDSLLDASSEFLSLEPQ-NESPE--LGKRR   47


NP_054828.2         44   AAQKKPAATTAKAGDG-SSVKEVETYHRTRALRSLR-KDAQNSSDSSFEK   91
XP_001148894.1      44   AAQKKPAATTAKAGDG-SSVKEVETYHRTRALRSLR-KDAQNSSDSSFEK   91
XP_002808533.1      44   AAQKQPVATTAKAGDG-SSVKEVGTYHRTRALRALR-KDAQNSSDSSFEK   91
XP_850520.1         44   AAE-QAAVTVAASGDG-SSVKEVETYHRTRASRSLR-KNAQNSSDSSFDK   90
NP_081711.2         45   AGRKSTASK--AAGDG-FTVKGAETYHNTRSLRSLR-NQAQTSSESSFDK   90
NP_001128351.1      45   AAGKSTVPKAEAAGDG-SSVKGVEICHNTRSLRSLR-KQAQTSSDSSSDK   92
XP_418453.4         44   ASAAAGPEGTERRGRSARFSSGKMECFHGHCLRPIR-KNITPRSDSSFEK   92
XP_003200296.2      27   ARLKKANDDSLTSAEDSPANEENSMRSRAQRGRHVAFADMNGQTSKSPPK   76
XP_002941445.2      48   SQRNTGTNGAARSGQGPFSDNEGPSSHTQKTLRKRKFEDLQSSPDKSLDK   97


NP_054828.2         92   NVEITEQLANGRHFTRQLARQQADKK-KEEHREDKVI--PVTRSLRARNI   138
XP_001148894.1      92   NVEITEQLANGRHFTRQLARQQADKK-KEEHREDKVI--PVTRSLRARNI   138
XP_002808533.1      92   NVEITEQLGNGRHFTRQLARQQADKK-KEERREDKVI--PVTRSLRTRNI   138
XP_850520.1         91   NMEITEKHSNRRHFTRQLARQQADKK-KEECKEDKVI--PVTRSLRTRNI   137
NP_081711.2         91   NVDRTEKYSNGRHFTRQFARQQAD-K-KEECKEDKVI--PVIRSLRNRNI   136
NP_001128351.1      93   NVERTEKYCNGRHFTRQLAQQQADKK-KEECQEDKAI--PVIRSLRNRNI   139
XP_418453.4         93   SMEILSESVNRRHFGRQLAKPKSDPK-KEEYKE-------VTRTLKTRAD   134
XP_003200296.2      77   EEK------SGKHL-RKSPRLQADGERSADEHTDEVDSTPTSRNLRARIQ   119
XP_002941445.2      98   TNEMNDKH-EVRRLTRRGAKQEADASMNGNCNGEELATSPCETSRRTRNT   146


NP_054828.2        139   VQSTEHLHEDNGDVEVRRSCRIRS-RYSGVNQSMLFDKLITNTAEAVLQK   187
XP_001148894.1     139   VQSTEHLHEDNGDVEVRRSCRIRS-RYSGVNQSMLFDKLITNTAEAVLQK   187
XP_002808533.1     139   VQSSEHLHEDNGDVEVRRSCRIRS-RYSGVNQSMLFDKLITNTAEAVLQK   187
XP_850520.1        138   VQTKEHLHEENGDIEVRRSCRIRS-RYSSVNQSVLFDKLITNTAEAVLQK   186
NP_081711.2        137   APTAEHLHEQSGDVEVRRSCRIRS-RYSTMNQSVLFDKLITNTAEAVLQK   185
NP_001128351.1     140   APSTEHLHEQSGDVEVRRSCRIRTCRYSTMNQSVLFDKLITNTAEAVLQK   189
XP_418453.4        135   AKAAKQVHEENGDLEVRRS------RYTTTNQSVLFDALITNTAEAVLQK   178
XP_003200296.2     120   RRGED-------DSAVRRSSRITRYKLDTRKQSVLYDRLITNTAEAVLQK   162
XP_002941445.2     147   EKAAA--HQVNGDVEVRRSGRIRRSRYSTTNQSVLFDKLITNTAEAVLQK   194


NP_054828.2        188   MDDMKKMRRQRMRELEDLGVFNETEESNLNMYT---RGKQK-DIQRTDEE   233
XP_001148894.1     188   MDDMKKMRRQRMRELEDLGVFNETEENNLNMYT---RGKQK-DIQRTDEE   233
XP_002808533.1     188   MDDMKKMRRQRMRELEDLGVFNETEESNLNMYT---RGKQK-DIQRTDEE   233
XP_850520.1        187   MDDMKKMRRQRMRELEDLGVFNETEEENLNVYT---RGKQK-GIQRTDEE   232
NP_081711.2        186   MDDMKKMRRQRMKKLEDLGVFNETEESNLTMYT---RGKLK-AIQRADEE   231
NP_001128351.1     190   MDDMKKMRRQRMKKLEDLGVFNETEESNLTMYT---RGKRK-AIQQADEE   235
XP_418453.4        179   MDDMEKMRRRHKKGLEDFGVFNKAKEN-LDMYS---CEKKE---------   215
XP_003200296.2     163   MDDMQKMRRRLRSR--------DSEEEKLRIYSGTKRTRITKPSVRGQEE   204
XP_002941445.2     195   MDHMKKMRRRRLRDLDELGVFNSTEES-IDMYS---RVKQKRGAARLDEE   240


NP_054828.2        234   TTDNQEGSVESSEEGEDQEHEDDGEDED-DEDDDDDDDDDDDDDDE--DD   280
XP_001148894.1     234   TTDNQEGSVESSEEGEDQEHEDDGEDEDEDDEDDDDDDDDDDDEDD--DD   281
XP_002808533.1     234   TTDNQEGSVESSEEGEDQEHEDDGEDED-----------DEDDDDE--DD   270
XP_850520.1        233   TTDNQEGSVESSEEGEDQE--------------------DDDGEDE--DD   260
NP_081711.2        232   TTDNQDGSVESSEEGEEQE--------------------DDDGEDE--DD   259
NP_001128351.1     236   TTDNQDGSVESSEEGEEQE--------------------DDDGEDEEDDE   265
XP_418453.4        216   --------IEGSDEPDNQQE-------------------LEASSEE--IE   236
XP_003200296.2     205   SSDNQENEYSDQDEEEEEEEDGEGEE-------------EENDEGD--AD   239
XP_002941445.2     241   TTDNQEESGETSEEGEEQDEDGDEEEEE-----------EDDDEEE--EE   277


NP_054828.2        281   EDEEDGEEENQKRYYLRQRKATVYYQAPLE-KPRHQRKPNIFYSGPASPA   329
XP_001148894.1     282   EDEEDGEEDNQKRYYLRQRKATVYYQAPLE-KPRHQRKPNIFYSGPASPA   330
XP_002808533.1     271   EDEEDG-EDNQKRYYLRQRKATVYYQAPLE-KPRHQRKPNIFYSGPASPA   318
XP_850520.1        261   DDEEDGEEDNQKRYYLRQRKATVYYQAPLE-KPRHQRKPNIFYSGPASPA   309
NP_081711.2        260   EDEEEGEEDNQKRYYLRQRKTTVYYQSPLESKPRHQRKPNMFYSGPASPA   309
NP_001128351.1     266   DEEEDGEEDNQKRYYLRQRKATVYYQAPLE-KPRHQRKPNMFYSGPASPA   314
XP_418453.4        237   GKEDDDVEDNQKRYDLRQRKTVVPYQAPLE-RPR--RRKILF----PSPR   279
XP_003200296.2     240   EDEDEDEEDNGKRYDFRQRKAVVRYQAPLE-EP---KKQSIFFKRHSTPL   285
XP_002941445.2     278   DDDEDGEEDNQKRYEFRQRKTVVPYQAPLA-EPRSYKKRGMFYDNTASPT   326


NP_054828.2        330   RPRYRLSSAGPRSPYCK-RM--------NRRRHAIHSSDSTSSSSSEDEQ   370
XP_001148894.1     331   RPRYRLSSAGPRSPYCK-RM--------NRRRHAIHSSDSTSSSSSEDEQ   371
XP_002808533.1     319   RPRYRLSSAGPRSPYCK-RM--------NRRRHAIHSSDSTSSSSSEDEQ   359
XP_850520.1        310   RPRYRLSSAGPRSPYCK-RM--------NRRRHAIHSSDSTSSSSSEDEQ   350
NP_081711.2        310   RPRFRLSSTGPRSPYCK-RM--------SRRRHAIHSSDST-SSSSSEDD   349
NP_001128351.1     315   RPRYRLSSSGPRSPYCK-RM--------NRRRHAIHSSDSTSSSSSSEDE   355
XP_418453.4        280   KRPSRLRRA---------AH--------NANSTSSSSPSPSSSSSSDEEE   312
XP_003200296.2     286   RRSYPFSSSSPRRPYNNRRSTSSRWSEGDGRRHAIHSSDST-SSSSSDEE   334
XP_002941445.2     327   RRYHRFGSAGPRSPYCKRRL--------NRRRHAIHSSDST-SSSSDDEQ   367


NP_054828.2        371   HFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD   420
XP_001148894.1     372   HFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD   421
XP_002808533.1     360   HFERRRKRSRNRAINRCLPLNFRKDELKGMYKDRMKIGASLADVDPMQLD   409
XP_850520.1        351   HFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD   400
NP_081711.2        350   CFERRTKRNRNRAINRCLPLNFRKDEIRGIYKDRMKIGASLADVDPMQLD   399
NP_001128351.1     356   CFERRRKRNRNRAINRCLPLNFRKDEIRGIYKDRMKIGANLADVDPMQLD   405
XP_418453.4        313   SVERRRMHSRNRTIRRCLPVNFQEDELKGVRKDRMKIGKSLADVDPMQID   362
XP_003200296.2     335   KFERRRTKSRNRSINRCLPMNLRKDDLLGIHKDRIKIGASLADVDPMQID   384
XP_002941445.2     368   HFERRLNRSRNKAISRCLPLNLQRDDLKGIQKDRMKIGASLADVDPMQID   417


NP_054828.2        421   SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPG   470
XP_001148894.1     422   SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPG   471
XP_002808533.1     410   SSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPG   459
XP_850520.1        401   SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPG   450
NP_081711.2        400   TSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPG   449
NP_001128351.1     406   SSVRFDSVGGLSSHIAALKEMVLFPLLYPEVFEKFKIQPPRGCLFYGPPG   455
XP_418453.4        363   SSVRFDAVGGLSDHISALKEMVVFPLLYPEVFERFKIQPPRGCLFYGPPG   412
XP_003200296.2     385   QTVRFDSIGGLGKHISALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPG   434
XP_002941445.2     418   ATVRFSSVGGLSKHISSLKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPG   467


NP_054828.2        471   TGKTLVARALANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQA   520
XP_001148894.1     472   TGKTLVARALANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQA   521
XP_002808533.1     460   TGKTLVARALANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQA   509
XP_850520.1        451   TGKTLVARALANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQA   500
NP_081711.2        450   TGKTLVARALANECSRGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQA   499
NP_001128351.1     456   TGKTLVARALANECSRGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQA   505
XP_418453.4        413   TGKTLVARALANECSQGNRRVAFFMRKGADCLSKWVGESERQLRLLFDQA   462
XP_003200296.2     435   TGKTLVARALANECSQGERKVAFFMRKGADCLSKWVGESERQLRLLFDQA   484
XP_002941445.2     468   TGKTLVARALANECSIGDRRVAFFMRKGADCLSKWVGESERQLRLLFDQA   517


NP_054828.2        521   YQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVV   570
XP_001148894.1     522   YQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVV   571
XP_002808533.1     510   YQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVV   559
XP_850520.1        501   YQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVV   550
NP_081711.2        500   YQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVV   549
NP_001128351.1     506   YQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVV   555
XP_418453.4        463   YQMRPSIIFFDEIDGLAPVRSSKQDQIHSSIVSTLLALMDGLDGRGEVVV   512
XP_003200296.2     485   YQMRPSIIFFDEIDGIAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVV   534
XP_002941445.2     518   YQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVV   567


NP_054828.2        571   IGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPL   620
XP_001148894.1     572   IGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPL   621
XP_002808533.1     560   IGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPL   609
XP_850520.1        551   IGATNRLDSIDPALRRPGRFDREFLFSLPDKDARKEILKIHTRDWNPKPL   600
NP_081711.2        550   IGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWNPKPV   599
NP_001128351.1     556   IGATNRLDSIDPALRRPGRFDREFLFSLPDKDARKEILKIHTRDWNPKPV   605
XP_418453.4        513   IGATNRLDSIDPALRRPGRFDREFLFGLPNKEARKEIFKIHTRDWTPKLL   562
XP_003200296.2     535   IGATNRLDSIDPALRRPGRFDREFLFNLPDREARKDILKIHTRHWDPQLS   584
XP_002941445.2     568   IGATNRLDSIDPALRRPGRFDREFLFSLPDQEARKDILKIHTKEWNPKPS   617


NP_054828.2        621   DTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLS   670
XP_001148894.1     622   DTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLS   671
XP_002808533.1     610   DTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLS   659
XP_850520.1        601   DIFLEELAENCVGYCGADIKSICSEAALCALRRRYPQIYTTSEKLQLDLS   650
NP_081711.2        600   DMFLEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLS   649
NP_001128351.1     606   DMFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLS   655
XP_418453.4        563   DTFIDELATECVGYCGADIKSLCAEAALCALRRRYPQIYLSSEKLQLDVN   612
XP_003200296.2     585   DAFLEELADKCVGYCGTDIKAVCAEAALCALRRRYPQIYASSQKLLLDVE   634
XP_002941445.2     618   DLFLDELSEKCVGYCGADIKSVCAEAALCSLRRRYPQIYTTTEKLQLDVD   667


NP_054828.2        671   SINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEAL   720
XP_001148894.1     672   SINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEAL   721
XP_002808533.1     660   SINISAKDFEVAMQKMIPASQRAVTSPGQALSTIVKPLLQSTVDKILEAL   709
XP_850520.1        651   SINISAKDFEVAMQKMIPAAQRAVTSPGQALSTVVKPLLQSTVHKILEAL   700
NP_081711.2        650   SITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDAL   699
NP_001128351.1     656   SINISAKDFETAMQKIIPASQRAVTSPGQALSAIVKPLLQNTVHMILEAL   705
XP_418453.4        613   SIKIKAKDFVMAMQKTVPASQRAVPSPGRALSPVMKPLLGNTLLRILQAL   662
XP_003200296.2     635   SICVSGRDFLSAMRKIVPASQRAVVSPAKALTPVIEPLLSAALNNAMKML   684
XP_002941445.2     668   SIKITAKDFITAMQKIVPASQRAVISPGQALSPIIQPLLQNTLCKVLKAL   717


NP_054828.2        721   QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHK   770
XP_001148894.1     722   QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHK   771
XP_002808533.1     710   QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYDNGLSQKSSHK   759
XP_850520.1        701   QRVFPHAEIRTNKALDSDISCPLLESDLAYSDDDVPSVYENGISQKSFNK   750
NP_081711.2        700   QKVFPHVEVGTNKSLNSDVSCPFLESDLAYSDDDTPSVYENGLSQ-----   744
NP_001128351.1     706   QKVFPHVEVGTNKALNSDVSFPLLESDLAYSDDDTPSMYENGLSQKNFNQ   755
XP_418453.4        663   QRVFPHAELAMKKDQQQGSSNPILKDDTIDRSDESPSIFEENVTDKVIC-   711
XP_003200296.2     685   QRLFPHVEQGLKKKRDTGNVSGILD-DLLQSEDEGSSVC---ITNKGQKN   730
XP_002941445.2     718   TKIFPHALEGIKKEKQSELSNHLLDEDLLYSDDEGLSVFDNGLPNKTPN-   766


NP_054828.2        771   AKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKF   820
XP_001148894.1     772   AKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKF   821
XP_002808533.1     760   AKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPGVIHALEKF   809
XP_850520.1        751   SKEKYNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKF   800
NP_081711.2        745   -KENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKF   793
NP_001128351.1     756   AKENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKF   805
XP_418453.4        712   -RPQEKFLNFSRKAYWQPTSCRPHLLLVGKTGYGQASHLAPAVLHALEMF   760
XP_003200296.2     731   TGPAVSVLHLTRSALQQPTSFRPRLLLCGTSGSAQTSHLAPAILHTLEKF   780
XP_002941445.2     767   -KPNRPFLQLHMSAHNHPTSYRPRLLLAGKPGHGQGTHLAPAAIHALEKF   815


NP_054828.2        821   TVYTLDIPVLFGVSTTSPEETCAQVIREAKRTAPSIVYVPHIHVWWEIVG   870
XP_001148894.1     822   TVYTLDIPVLFGVSATSPEETCAQVIREAKRTAPSIVYVPHIHVWWEIVG   871
XP_002808533.1     810   TVYTLDIPVLFGVSATSPEETCAQVIREAKRTAPSIVYVPHIHLWWEIVG   859
XP_850520.1        801   AVYTLDIPVLFGVSATSPEETCAQMIREAKRTAPSIVYVPHIHLWWEIVG   850
NP_081711.2        794   TVYTLDIPVLFGISTTSPEEACSQMIREAKRTAPSIVYVPHIHLWWEIVG   843
NP_001128351.1     806   TVYTLDIPVLFGISTTSPEEACSQMIREAKRTAPSIVYVPHVHLWWEIVG   855
XP_418453.4        761   PVHTLDMSVLF-VSMSSPEETCAQLIREAQRTAPSIIYIPHIHLWWDSVG   809
XP_003200296.2     781   TVYTLDVAVLYGVSSATPEEACAQVFCEARRTAPSIVYIPHIQRWWDTVS   830
XP_002941445.2     816   TVYTADLAVLFGVGATSPEETCAQLFREAKRTAPSILYIPHIHLWWETVS   865


NP_054828.2        871   PTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQELFIRDYGEIFN   920
XP_001148894.1     872   PTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQELFIRDYGEIFN   921
XP_002808533.1     860   PTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQELFIRDYGEIFN   909
XP_850520.1        851   PTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQELFIRDYGEIFN   900
NP_081711.2        844   PTLKATFTTLLQTIPSFAPVLLLATSEKPYSALPEEVQELFTHDYGEIFN   893
NP_001128351.1     856   PTLRATFTTLLQNIPSFAPVLLLATSERPYSALPEEVQELFTHDYGEIFN   905
XP_418453.4        810   ATLKATFTSLIQNIPTFAPVLLLATSDVRHADLPDEVQALFNNDFGEVFN   859
XP_003200296.2     831   PTLRATFISLLQDIPSFCPCLLLATCSFPHDALYTEVQDLFHVEYGEVFD   880
XP_002941445.2     866   DTLKATFVTLLKSIPSFSPILLLATCDVDHYKLPHELQELFVEEYGEVFH   915


NP_054828.2        921   VQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSL   970
XP_001148894.1     922   VQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSL   971
XP_002808533.1     910   VQLPGKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSL   959
XP_850520.1        901   VQLPGKEERTKFFEDLILKQAAKPPVSKKKAVLQALEVLPVAPPPEPRPL   950
NP_081711.2        894   VQLPDKEERTKFFEDLILKQASKPPVSQKKAVLQALEVLPVAPPPEPRPL   943
NP_001128351.1     906   VQLPDKEERTKFFEDLILKQAAKPPVSQKKAVLQALEVLPVAPPPEPRPL   955
XP_418453.4        860   IQSPNKDERRSFFEDLILNQAAKPPTSKKKAAGQTLEALPVAPPPEPRPL   909
XP_003200296.2     881   VPLPSRDERLRFFEDLILNQAAKAPASKREAVLQALEVLPVAPPPPPRLL   930
XP_002941445.2     916   VLLPNKEERRVFFEDLIINQAAKAPVSKKKAVLQALEVLPVAPPPEPRTL   965


NP_054828.2        971   TAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD   1020
XP_001148894.1     972   TAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD   1021
XP_002808533.1     960   TAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD   1009
XP_850520.1        951   TPEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD   1000
NP_081711.2        944   TAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD   993
NP_001128351.1     956   TAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD   1005
XP_418453.4        910   TEEEMKCLEEQEEDTLRELRIFLRDVTHRLAIDKRFRAFTKPVDPEEVPD   959
XP_003200296.2     931   TKQELQKLEEQEEDTLRELRLFLRDVTNRLAQDKRFKAFTKPVDTEEVPD   980
XP_002941445.2     966   SAEELKQLEEQEESTLRELRLFLRDVSHRLAIDKRFRVFTKPVDPEEVPD   1015


NP_054828.2       1021   YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPG   1070
XP_001148894.1    1022   YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPG   1071
XP_002808533.1    1010   YVTXIKQQWDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPG   1059
XP_850520.1       1001   YVTVIKQPMDLSSVISKIDLHKYLTVKDYLSDIDLICSNALEYNPDRDPG   1050
NP_081711.2        994   YVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPG   1043
NP_001128351.1    1006   YVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPG   1055
XP_418453.4        960   YDTVIKQPMDLSTVLSKIDLHQYLTAGDFLKDIDLICSNALEYNPDKDPG   1009
XP_003200296.2     981   YTTVIKQPMDLSTVLSKIDLHKYETVAAYLEDVDLIWQNALEYNPDRDPS   1030
XP_002941445.2    1016   YVTVIAQPMDLSTVISKIDLHKYHTVKEYLKDIDLICSNALEYNPDKDPG   1065


NP_054828.2       1071   DRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1120
XP_001148894.1    1072   DRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1121
XP_002808533.1    1060   DRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1109
XP_850520.1       1051   DRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1100
NP_081711.2       1044   DRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1093
NP_001128351.1    1056   DRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1105
XP_418453.4       1010   DRLIRHRACSLKDTAYSIVKEEIDEDFEQLCEEIKESRKKRGCSSSKYAP   1059
XP_003200296.2    1031   DRLIRHRACALKDTVHAIIRDELDEDFEKICVEMKESRSKRGSSSSRFTP   1080
XP_002941445.2    1066   DRLIRHRACTLKDATYAIIKEELDEEFEKLCEEIQESRKKRGFCASAFAP   1115


NP_054828.2       1121   SYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTP--AQLKR----   1164
XP_001148894.1    1122   SYYHVMPKQNPTLVGDKRSDPEQNEKLKTPSTPVACSTP--AQLKR----   1165
XP_002808533.1    1110   SYYHVMPKQNSTLAGDKRSDPEQNEKLKTPSTPMACSTP--AQLKR----   1153
XP_850520.1       1101   SYYHVMPKQNSTSAGEKRSDPEQNEKLKTPSTPVACSTP--AQLKR----   1144
NP_081711.2       1094   SYYHVMPKQNSPPVGDKKPDQEQNEKLKVPCTPVACSTP--AQLKR----   1137
NP_001128351.1    1106   SYYHVMPKQNSTPVGDKRSDQEQKEKLKAPCTPMASSTP--ARLKR----   1149
XP_418453.4       1060   AFYTVMPKQNSAP-GCKKTDAKCNEKAKMTVAPVDASTPLSNDASK----   1104
XP_003200296.2    1081   AYYHVLPKVSAT--AEQKTSDPTPSKEATPLSAQAVISPRQAGINTASQM   1128
XP_002941445.2    1116   TFYHVLPKQNGFTDGKK----AETEKTGQSSVPLAASTP-----------   1150


NP_054828.2       1165   KIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHKIESDTEE---TQDTSVD   1211
XP_001148894.1    1166   KIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHKIESDTEE---TQDTSVD   1212
XP_002808533.1    1154   KIRKKSKWYLGTIKKRRKISQAKDDSQNAMDHKIESDTEE---TQDTSVD   1200
XP_850520.1       1145   KIRKKSKWYLGTITKRRRISQVKDESQNTTDDKIESDTEE---NQDTSVD   1191
NP_081711.2       1138   KFHKKSKWHVGTKIKRRKISQAKDNSLNAMNSSSRSDTED---SQHTHAE   1184
NP_001128351.1    1150   KFRKKSKWHVGTKIKRRKISQAKDSSQTAVNSASRSDSED---SQHT---   1193
XP_418453.4       1105   RKRKKTKFSSSVAAKRKRSFQFNKENKIPRDDLNESDGEDFLASYTSTTD   1154
XP_003200296.2    1129   KKKRKNRWKNGFISKKKCSHVNSKDNSNIAESGDEEEDED---EDGKPAE   1175
XP_002941445.2           --------------------------------------------------


NP_054828.2       1212   HNETGNTGESSVEENEKQQNASESKLELRN-NSNTCNIENELEDSRKTTA   1260
XP_001148894.1    1213   HNETGNTGESSVEENEKQQNASESKLELRN-NSNTCNIENELEDSRKTTA   1261
XP_002808533.1    1201   HNETGNTGESSVEENEKQQNASESKLELRN-NSNTCNIENELEDSRKTTA   1249
XP_850520.1       1192   HNETGNTGESSVEENEKHQNASESRIELRNKNSSICGIENELEESEKTTA   1241
NP_081711.2       1185   HTEPGNTDESSVEESDK-QNRLESNIDLKN-NSSSSNIENELEEPKETTE   1232
NP_001128351.1    1194   RTELGNTGESSVEESDK-QNTSESNIDLKN-NSSSSNIENELEEPKQTAE   1241
XP_418453.4       1155   QTEFESSQDSTWEESETVLQERQT-----NGNENKAGSEKERERGLFDTE   1199
XP_003200296.2    1176   SEDLEKMRDAECETMEVEGPTTSTSVVQKI---TFVSEEQEDNTAAAVNE   1222
XP_002941445.2           --------------------------------------------------


NP_054828.2       1261   CTEL-RDKIACNG--------DASSSQIIHISDENEGK-EMCVLRMTRAR   1300
XP_001148894.1    1262   CTEL-RDKIACNG--------DASSSQIIHISDENEGK-EMCVLRMTRAR   1301
XP_002808533.1    1250   CTELRREKTACNG--------DASSSQIIHISDENEGK-EMCVLRMTRAR   1290
XP_850520.1       1242   CTEVRKDKIVCNG--------DASGSQIIDISNENEAK-EMCILRMTRAR   1282
NP_081711.2       1233   GTELRKDRIVCRG--------DASASQVTDIPEDSESK-EMDFLRMTLAR   1273
NP_001128351.1    1242   GTELKKARIVCSG--------DAATSQVTDIAEENESK-EMGFLRMTRAR   1282
XP_418453.4       1200   TSADEKESVGLPGHSDLRRESDISVCQKPDCSEEQEAN-DPWVLRMTRAR   1248
XP_003200296.2    1223   VVNVENVQINASGEQNDVQPLDNNEPKRTEPGAEDDTEMEFRPRRLTRGF   1272
XP_002941445.2    1151   ---------------------------------------NVHFMRMTRGR   1161


NP_054828.2       1301   RSQVEQQQLITVEKALAILSQPTPSLVVDHERLKNLLKTVVKKSQNYNIF   1350
XP_001148894.1    1302   RSQVEQQQLISVEKALAILSQPTPSLVVDHERLKNLLKTVVKKSQNYNIF   1351
XP_002808533.1    1291   RSQVEQQQLISVEKALAILSQPTPSLVVDHERLKNLLKTVVKKSRNYNIF   1340
XP_850520.1       1283   RSQVEQQQLISVEKALAILSQPTPSLVVDHERLKNLLKTVVKKSQEYNIF   1332
NP_081711.2       1274   GSQVEQQELISMEQALAILSQPTPSLVLDHKQLTNILKTVVKKSQKYNIF   1323
NP_001128351.1    1283   HSQVEQQQLIGMEKALAILSQPTPSLVVDHKHLKNLLKTVVKKSQEYNIF   1332
XP_418453.4       1249   RSQAELRQM-SAERVMDTVTESAAVVMVDYCELKQLLHMVTELTKEADIF   1297
XP_003200296.2    1273   KSQAEQQSLISVDAAMKILEQKNVPLIVDHNKLKELLQKVVDMTEGYEVN   1322
XP_002941445.2    1162   QLQVEQQQLVSVEEAMEVLSEATPALYVDHQKLKNLLDKAVVRSNEYNVF   1211


NP_054828.2       1351   QLENLYAVISQCIYRHRKDHDKTSLIQKMEQEVENFSCSR-   1390
XP_001148894.1    1352   QLENLYAVISQCIYLHRKDYDKTSLIQKMEQEVENFSCSR-   1391
XP_002808533.1    1341   QLENLYAVISQCIYQHRKDYDKTSLIQKMEQEVENFSCSR-   1380
XP_850520.1       1333   QLENLYAVISQCIYQHRMDYDKTRLIQKMEQEVENFSCSRS   1373
NP_081711.2       1324   QLENLYAVISQCIYEHRRDYDKTALVQKMEQAVENFNCSRS   1364
NP_001128351.1    1333   QLENLYAVLSQCIYEHRRDYDKTALVQKMEQAVENFSCSRS   1373
XP_418453.4       1298   HFEKLYAAICQCIYQHREDHNKTELLKVMKKEIKALALI--   1336
XP_003200296.2    1323   QLEKLYALLCQSIYRHRKDYDKTALIQACLDA-KALGV---   1359
XP_002941445.2    1212   QLEKMYALLSQCIYRHRKDYDKTMLLKEMEDEINGF---RK   1249


Protein Acc. Gene Organism
NP_054828.2 ATAD2 H.sapiens
XP_001148894.1 ATAD2 P.troglodytes
XP_002808533.1 LOC704478 M.mulatta
XP_850520.1 ATAD2 C.lupus
NP_081711.2 Atad2 M.musculus
NP_001128351.1 Atad2 R.norvegicus
XP_418453.4 ATAD2 G.gallus
XP_003200296.2 wu:fi16e04 D.rerio
XP_002941445.2 atad2 X.tropicalis


Support Center