Display Settings:

Format

Send to:

Choose Destination
HomoloGene:56606. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_055409.1              --------------------------------------------------
XP_003950740.1           --------------------------------------------------
XP_005626408.1       1   MVIAFVYESRGLSGCGTAPAFLRRWRGLAAELGRPAWGGDLPGALPVAAV   50
XP_002688547.2           --------------------------------------------------
NP_038950.3              --------------------------------------------------
NP_076478.1              --------------------------------------------------


NP_055409.1              --------------------------------------------------
XP_003950740.1           --------------------------------------------------
XP_005626408.1      51   LLAPAAGREGSAEPAGPLAGTGRRGAAGGRRPVPAGPAAVRGGAGVAGAR   100
XP_002688547.2           --------------------------------------------------
NP_038950.3              --------------------------------------------------
NP_076478.1              --------------------------------------------------


NP_055409.1          1   ----------------------------MAVDLLSAQ--EPVTFRDVAVF   20
XP_003950740.1       1   ----------------------------MAVDLLSAQ--EPVTFRDVAVF   20
XP_005626408.1     101   DPRGVGARCQTYLVSRLHSLDRKTEKERMAVDLLPTEVTESVTFRDVAVL   150
XP_002688547.2       1   ----------------------------MGLPL---Q--ESVTFRDIAVL   17
NP_038950.3          1   ----------------------------MAVDLLAARGTEPVTFRDVAVS   22
NP_076478.1          1   ----------------------------MAVDLLAARGTEPVTFRDVAVS   22


NP_055409.1         21   FSQDEWLHLDSAQRALYREVMLENYSSLVSLGIPFSMPKLIHQLQQGEDP   70
XP_003950740.1      21   FSQDEWLHLDSAQRALYREVMLENYGSLVSLGIPFSMPKLIHQLQQGEDP   70
XP_005626408.1     151   FSHDEWLHLDSAQRTLYREVMLENYGTLVSLGIPFSTPKVIYQLQQGEDP   200
XP_002688547.2      18   FSRDEWLHLDAAQRTLYREVMLENYSTLVSLGIPFSMPKLICQLQQGEDP   67
NP_038950.3         23   FSQDEWLHLDPAQRSLYREVMLENYSNLASLGFQASIPPVIGKLQKGQDP   72
NP_076478.1         23   FSQDEWLHLDPAQRTLYREVMLENYSNLASLGFQASIPPVIGKLQKGQDP   72


NP_055409.1         71   CMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHW   120
XP_003950740.1      71   CMVEREVPSDTCLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHW   120
XP_005626408.1     201   CTVDREVPQDACVGFKTQPEMESLPSTQDISREETFQGIIKKRSVKFGHG   250
XP_002688547.2      68   CMVEREIPQDTCLGFKIWPEIEALPRKQDISSGETSQGIIMKNSIK---L   114
NP_038950.3         73   CM-EREAPEDTCLDFEIWPEIEALPPKQDVLTKETSHGLIKNGSTKCVYW   121
NP_076478.1         73   CM-EREAPEDTCLDFQIQSEIEASSPEQDVFIEGPSRGLLKNRSTKCAYW   121


NP_055409.1        121   DINFEEAVEFES-EIEEEQEKKPLRQMIDSHEKTISEDGNHTSLELGKSL   169
XP_003950740.1     121   DINFEEAVEFES-GIEEEQEKKPLRQMIDSHEKTISEDGNHTSLELGKSL   169
XP_005626408.1     251   DTNFGQTMEFES-ETEQEQQKKPLRQMVASHKNPGIGDVKQISLELGKGF   299
XP_002688547.2     115   DIKCGEALEFE--GRTQEQQKKTLRQMVASQKQTISRTGDQTSLELGKGL   162
NP_038950.3        122   KISFGELVKTECRDIAQEQEKKVHGPGAESPKETTSEDGTPTGFEPEKPL   171
NP_076478.1        122   KISFGELVKYERLETAQEQEKKAHEPGAASPKEVTSEDGIPTDPELEKPL   171


NP_055409.1        170   FTNTALVTQQSVPIERIPNMYYTFGKDFKQNFDLMKCFQIYPGGKPHICN   219
XP_003950740.1     170   FTNTALVTQQSVPIERIPNMYYTFGKDFKQNFDLMKCFQIYPGGKPHICN   219
XP_005626408.1     300   LIDTILVTQQTVPVGRIPNIYYTFGKDFKQNFDLMRRFQIYPGEKPYICN   349
XP_002688547.2     163   FINTVLIRQQNVPTERVPSVYYTFGRDFKQNFDLMRCFQIYPGEKPHIYN   212
NP_038950.3        172   FISKALVSQEGDPTESVPATYHTSEKDLPQDFDLMRSFQMYPGQKPHVCS   221
NP_076478.1        172   FMNKALVSQETDPIERVPGMYHTSEKDLPQDFDLMRNFQIYPGQKPYVCS   221


NP_055409.1        220   ECGKSFKQNLHLIEHQRIHTGEKPYKCNECEKTFSHRSSLLSHQRIHTGE   269
XP_003950740.1     220   ECGKSFKQNLHLIEHQRIHTGEKPYKCNECEKTFSHRSSLLSHQRIHTGE   269
XP_005626408.1     350   ECGKSFNQSLHLIEHQRIHTGEKPYRCSECEKTFSHRSSLLAHQRIHTGE   399
XP_002688547.2     213   ACDKSFNQSLHLIERQRIHTGEKPYKCSECGKTFSHRSSLLAHQRIHTGE   262
NP_038950.3        222   ECGKGFTQSLHLLEHKRLHTGEKPYKCSECGKSFSHRSSLLAHQRTHTGE   271
NP_076478.1        222   ECGKGFSQSLHLLEHKRIHTGEKPYKCSECGKSFSHRSSLLAHQRTHTGE   271


NP_055409.1        270   KPYKCNECEKAFSNSSTLIKHLRVHTGEKPYRCRECGKAFSQCSTLTVHQ   319
XP_003950740.1     270   KPYKCNECEKAFSNSSTLIKHLRVHTGEKPYRCRECGKAFSQCSTLTVHQ   319
XP_005626408.1     400   KPYKCNECEKAFSSSSTLIKHLRVHTGEKPYQCKECGKAFSQCSTLTVHQ   449
XP_002688547.2     263   KPYKCNQCEKAFSSSSTLIKHLRVHTGEKPYQCKDCGKAFSQCSTLTVHQ   312
NP_038950.3        272   KPYKCSECEKAFGSSSTLIKHLRVHTGEKPYRCRQCGKAFSQCSTLTVHQ   321
NP_076478.1        272   KPYKCSECEKAFGSSSTLIKHLRVHTGEKPYRCRECGKAFSQCSTLTVHQ   321


NP_055409.1        320   RIHTGEKLYKCGECEKAFNCRAKLHRHQRIHTGEKPYKCSECGKGYSQFT   369
XP_003950740.1     320   RIHTGEKLYKCGECEKAFNCRAKLHRHQRIHTGEKPYKCSECGKGYSQFT   369
XP_005626408.1     450   RIHTGEKLYKCTECEKAFNCRAKLQRHQRIHTGEKPYKCSECGKGYSQFA   499
XP_002688547.2     313   RIHTGEKLYKCGECEKAFNCRAKLHRHQQIHTGEKPYKCSECGKSYSQFT   362
NP_038950.3        322   RIHTGEKLYKCAECDKAFNCRAKLHRHQRIHTGEKPYKCAECGKGYSQFP   371
NP_076478.1        322   RIHTGEKLYKCAECDKAFNCRAKLHRHQRIHTGEKPYKCAECGKGYSQFP   371


NP_055409.1        370   SLAEHQRFHTGEQLYTCLECGRTFTRIVTLIEHQRIHTGQKPYQCNECEK   419
XP_003950740.1     370   SLAEHQRFHTGEQLYKCLECGRTFTRIATLIEHQRIHTGQKPYQCNECEK   419
XP_005626408.1     500   SLAEHQRLHTGEQLCKCLECGRTFTRISTLTEHQRIHMDQKPYQCTECGK   549
XP_002688547.2     363   SLAEHQRLHTGEQLCKCLECGRNFTRISTFIEHQRIHTGQKPYQCNECGK   412
NP_038950.3        372   SLAEHQRLHTGEQLCQCLQCGRTFTRVSTLIEHQRIHTGQKPYQCNECGK   421
NP_076478.1        372   SLAEHQRLHTGGQLCQCLQCGRTFTRVSTLIEHQRIHTGQKPYQCNECGK   421


NP_055409.1        420   AFNQYSSFNEHRKIHTGEKLYTCEECGKAFGCKSNLYRHQRIHTGEKPYQ   469
XP_003950740.1     420   AFNQYSSFNEHRKIHTGEKLYTCEECGKAFGCKSNLYRHQRIHTGEKPYQ   469
XP_005626408.1     550   TFNQYSSFNEHRKIHTGEKLYSCEECGKAFGCKSNLYRHQRIHTGEKPYQ   599
XP_002688547.2     413   AFNQYSSFNDHRKIHTGEKLYTCGECGKAFGCKSNLYRHQRIHTGEKPYQ   462
NP_038950.3        422   TFNQYSSFNEHRKIHTGEKLYTCEECGKAFGCKSNLYRHQRIHTGEKPYQ   471
NP_076478.1        422   TFNQYSSFNEHRKIHTGEKLYTCEECGKAFGCKSNLYRHQRIHTGEKPYQ   471


NP_055409.1        470   CNQCGKAFSQYSFLTEHERIHTGEKLYKCMECGKAYSYRSNLCRHKKVHT   519
XP_003950740.1     470   CNQCGKAFSQYSFLTEHERIHTGEKLYKCMECGKAYSYRSNLCRHKKVHT   519
XP_005626408.1     600   CNQCGKAFSQYSFLTEHERIHTGEKLYKCLECGKAYSYRSNLCRHKKVHN   649
XP_002688547.2     463   CNQCGKAFSQYSFLTEHERIHTGEKLYKCMECGKAYSYRSNLCRHKKVHN   512
NP_038950.3        472   CNQCGKAFSQYSFLTEHERIHTGEKLYKCMECGKAYSYRSNLCRHKKVHL   521
NP_076478.1        472   CNQCGKAFSQYSFLTEHERIHTGEKLYKCMECGKAYSYRSNLCRHKKVHL   521


NP_055409.1        520   KEKLYKWKEYG-KPFICSSSLTQYQRFFKGDKAYEV----   554
XP_003950740.1     520   KEKLYKWKEYG-KPFICSSSLTQYQRFLKGDKAYEG----   554
XP_005626408.1     650   KEKLYKWKEYG-KPFIYSSSLTQYQRFLRGDKASEV----   684
XP_002688547.2     513   KEKLYKWKEYGVRDFLEEISL-------------------   533
NP_038950.3        522   KERLYKWKEYG-TPFIYGSSLTPYQKFLKGDKPENFNSSL   560
NP_076478.1        522   KERLYKWKEYG-TPFMYGSSLAPHQRCLKGEKPEDLNSSL   560


Protein Acc. Gene Organism
NP_055409.1 ZNF354C H.sapiens
XP_003950740.1 ZNF354C P.troglodytes
XP_005626408.1 ZNF354C C.lupus
XP_002688547.2 ZNF354C B.taurus
NP_038950.3 Zfp354c M.musculus
NP_076478.1 Zfp354c R.norvegicus


Support Center