Display Settings:

Format

Send to:

Choose Destination
HomoloGene:55706. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002967.2          1   -------MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEED-LKPTP   42
XP_515875.4          1   -------MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEED-LKPNP   42
XP_002808047.1       1   -------MLASPEPKGLVPFTKESFELIKQHIAKTHNEEH-EED-LKPNP   41
XP_545504.3          1   MVASRKLEMASREPKGLVPFTRESLEFMKQHIAKKHSEEQ-R-D-LTPNT   47
XP_002685417.2       1   MAARAKLKMVSPEPKSLVPFTRESLEVMEQHSAKKPSEED-KED-LKPNC   48
NP_033161.2          1   -------MLTSPEPKGLVPFTTESLELIENHIAKKCNEDPEEEEGLKPSR   43
NP_113874.1          1   -------MLTSPEPKGLVPFTAESLELIKNHIAKKCNEEHEEED-LKPSR   42


NP_002967.2         43   DLEVGKKLPFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRF   92
XP_515875.4         43   DLEVGKELPFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRF   92
XP_002808047.1      42   DLEVGKELPFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRF   91
XP_545504.3         48   DLEVGKELPFAYGNLPQGMVLEPLEDVDP-YYKNKNTFMVLNKSRTIFRF   96
XP_002685417.2      49   DLEVGKELPFAYGNLPQAMVSEPLEDVDP-YYTNKRTFIVLNKKRTIFRF   97
NP_033161.2         44   NLEAGKRLPIPYGTLPRGTVSEPLEDVDPYYYVKRNTFMVLNRSRVIFRF   93
NP_113874.1         43   DIEAGKKLPFAYGTLPQGTVSEPLEDVDPYYYVKRNTFMVLNRNRVIFRF   92


NP_002967.2         93   NAASILCTLSPFNCIRRTTIKVLVHPFFQLFILISVLIDCVFMSLTNLPK   142
XP_515875.4         93   NAASILCTLSPFNCIRRTTIKVLVHPFFQLLILISVLIDCVFMSLTNLPK   142
XP_002808047.1      92   NAASILCTLSPFNCIRGTTIKVLAHPFFRLFILISVLLDCIFMSLTNLPK   141
XP_545504.3         97   NAT--WCTFSPFSSTRRTTIKILVHPFFRLFILISVLIDCIFMSMTEMPK   144
XP_002685417.2      98   NAT--WCTLSPFNSIRRATIKILVHPFFRLFILVSVLTDCIYMSMTDLPK   145
NP_033161.2         94   NAVSIFCTLSPLNSLRRAAIKALVHPLFRLLILISVLTDSILMCMSNLPE   143
NP_113874.1         93   NAVSILCTLSPLSSLRRAVIKVLVHPLLRLLILISVLTDSILMCMSNLPE   142


NP_002967.2        143   WRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPWNWLDFSVTVFEV   192
XP_515875.4        143   WRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPWNWLDFSVTVFEV   192
XP_002808047.1     142   WRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPWNWLDFSVTMFEV   191
XP_545504.3        145   WGPVLQNTLLGIYTFEILIKLIARGIWVEPFYFFGDPWNWLDFSVTLFEH   194
XP_002685417.2     146   WGPALQNTLLGIYTFEILVKLIARGIWAGPFYFFGDSWNWLDFSVTLFEH   195
NP_033161.2        144   WILAIENTLLGIYAFEILVKVIARGIWAGSFSFLGDLWNWLDFSVTLFEL   193
NP_113874.1        143   WILAVENTCLGIYTFEILVKVIARGIWAGSFSFLGDLWNWLDFSVTLFEL   192


NP_002967.2        193   IIRYSPLDFIPTLQTARTLRILKIIPLNQGLKSLVGVLIHCLKQLIGVII   242
XP_515875.4        193   IIRYSPVDFIPMLQTARTLRILKIIPLNQGLKSLVGVLIHCLKKLIGVII   242
XP_002808047.1     192   IIRYSPLNFIPMLQTARTLRILKIIPLNQGLKSLAGVLTHCLKKLIGVII   241
XP_545504.3        195   ITRYLPLYFIPIFRISRNLRILKIIPLNQGLRSFVGILIHCLKKLTGVIT   244
XP_002685417.2     196   ISRYSPLNFISVCRIMRNLRILKIIPLNQGLKSFVAILIHCLKKLTVVII   245
NP_033161.2        194   ITRFSPLSSFLMLKTIRTFRILKIIPLNHGLQSIVMTLAQCLKKLFGAIA   243
NP_113874.1        193   ITRSSPLSSLPMFKTIRTLRILKIIPLNHGLQSIVVTLVQCLKKLLGAIA   242


NP_002967.2        243   LTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRET   292
XP_515875.4        243   LTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYTRET   292
XP_002808047.1     242   LTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNKTGNPYYIRET   291
XP_545504.3        245   LTLFFLSVFSLIGMGLFMGNLKHKCLRWPQENETATLHNKTGNPYYIRET   294
XP_002685417.2     246   LTLFFLSVFSLIGMGLFMGNLKHKCLRWPQENETDMLNNRTGNPYYIRET   295
NP_033161.2        244   LALFFLAVFSLLGMGLFMGNLKHKCLRWPEENENETLHNRTGSLNYSPER   293
NP_113874.1        243   LALFFLTVSSLFGMGLFMGNLKHKCVRWPQEDGNDVMYSGTGSQYHILER   292


NP_002967.2        293   ENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWA   342
XP_515875.4        293   ENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWA   342
XP_002808047.1     292   ENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWA   341
XP_545504.3        295   ENFYYLEGENSALLCGNRTDAGQCPEGYVCVKAGTNPDYGFTNFDTFGWA   344
XP_002685417.2     296   ENFYYLEGERYALLCGNRSDASQCPEGYVCVKAGVNPDDGYTNFDSFGWA   345
NP_033161.2        294   INFYYMEGAKYALLCGNRTDAGQCPEGYVCVKEGTNPDNGFTSFDNFGWS   343
NP_113874.1        293   ENFYYMEGARYALLCGNKTDAGLCPEGYMCVKEGSNPDNGFTSFDNFGWA   342


NP_002967.2        343   LFALFRLMAQDYPEVLYHQILYASGKVYMIFFVVVSFLFSFYMASLFLGI   392
XP_515875.4        343   LFALFRLMAQDYPEVLYHQILYASGKVYMIFFVVVSFLFSFYMASLFLGI   392
XP_002808047.1     342   LFALFRLMAQDYPEVLYHQILYASGKVYMIFFVMVSFWFSFYMASLFLGI   391
XP_545504.3        345   LLAMFRLMTQDYPEALYHQILYASGKVYMIFFVVISFWFAFYIASLFLGI   394
XP_002685417.2     346   LLALFRLMTQDYPEALYHQILYASGKVYMVFFVVISFWFAFYMASLFLGL   395
NP_033161.2        344   LLAMFRLMTQDYPELLYHQILYASGKVYMIFFVMISFWFAFYLTSLFLGI   393
NP_113874.1        343   LLAMFRLMTQDYPELLYHQILYASGKIYMIFFVLISFWFAFYMASLFLGI   392


NP_002967.2        393   LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETD-------------   429
XP_515875.4        393   LAMAYEEEKQRVGERSKKIEPKFQQTGKELQEGNETD-------------   429
XP_002808047.1     392   LAMAYEEEKQRVGQTSKKIEPKFQQTGKELQEGNETD-------------   428
XP_545504.3        395   LAKSCEEEKLKTKAR--KVEPKFQQTLKELQERNEAA-------------   429
XP_002685417.2     396   LAISYEEEKQTAAEKA-TIDQEFQKSLPELQEEKITA-------------   431
NP_033161.2        394   LTMTYEKEKQRACEESGGLDPKCQQTVKELDEENDAA-------------   430
NP_113874.1        393   LTMAYEQEKQRASEESRDMDSKCHQTVKEFEEEHEGAELQCIWFYEEVLD   442


NP_002967.2        430   ---------EAKTIQIEMKKRSPISTDTSLDVLED--ATLRHKEELEKSK   468
XP_515875.4        430   ---------E---VLYPLEKKEGLELCRPAESV----AGLR-KHKLEKSK   462
XP_002808047.1     429   ---------EAKTIQIEMKKRSPTSTDTSLDVLED--ATLRHKEELEKSK   467
XP_545504.3        430   ---------ETNATQIEMKKRSPTSIITSLNMLDDAAAAIRHEEELKKSR   470
XP_002685417.2     432   ---------ETKTIQIEMKKRSSTSVITSLDVLGD--ATISHKEELKKSR   470
NP_033161.2        431   ---------EMETTQIEMKKRSPTSINTTLDILED--TTLGHREEPETSR   469
NP_113874.1        443   LLGLELCIKEMETTQIEMKKRSPTSINTTLDILED--TALGHKEEPETSR   490


NP_002967.2        469   KICPLYWYKFAKTFLIWNCSPCWLKLKEFVHRIIMAPFTDLFLIICIILN   518
XP_515875.4        463   KICPLYWYKFAKTFLIWNCSPCWLKLKEFVHRIRMAPFTDLFLIICIILN   512
XP_002808047.1     468   KICPLYWYKFATTFLIWNCSPCWSKLKEFVHRIVMAPFTDLFLIICIILN   517
XP_545504.3        471   KRCPSCWYRCTKTFLIWNCSPCWLKLKEFIHMIIMDPFTDLVLAICIILN   520
XP_002685417.2     471   QRCPFCWYEFAKTFLIWDCSPCWLKLKEFVHRIIMDPFTDLFLTICIILN   520
NP_033161.2        470   KKCPICWHKFIKTCFIWKCSPCWVKLNEFADRVITHPLADLFLVICIVLN   519
NP_113874.1        491   KECPLCWYKFTKTCFIWKCSPCWIKLNEFADRIITHPLFDLFLVICIILN   540


NP_002967.2        519   VCFLTLEHYPMSKQTNTLLNIGNLVFIGIFTAEMIFKIIAMHPYGYFQVG   568
XP_515875.4        513   VCFLTLEHYPMSKQTNTLLNIGNLVFIGIFTAEMIFKIIAMHPYGYFQVG   562
XP_002808047.1     518   ICFLALEHYPMSKSTNNLLNIGNLVFIGIFTAEMIFKIIAMHPYGYFQVG   567
XP_545504.3        521   ICFLALDSYPMSEETKNVLSIGNLICVGIFTAEMILKIIAMHPYGYFQVG   570
XP_002685417.2     521   IHFLALEHYPMSLETSNILSIGNVVFIGIFTAEMIFKIIAMYPYGYFQVG   570
NP_033161.2        520   ICFLALEHFPMSEELRSLLHVGNLVFIGIYTIEMILKIIAMHPYGYFQIS   569
NP_113874.1        541   ICFLALEHFPMSEELMSLLAIGNLVFIGIYTIEMILKIIAMHPYGYFQIS   590


NP_002967.2        569   WNIFDSMIVFHGLIELCLANVAGMALLRLFRMLRIFKLGKYWPTFQILMW   618
XP_515875.4        563   WNIFDSMIVFHGLIELCLANVAGMALLRLFRMLRIFKLGKYWPTFQILMW   612
XP_002808047.1     568   WNIFDSVIVFHGLTELCLANVEGMALLRLFRMLRIFKLGKYWPTFQILMR   617
XP_545504.3        571   WNIFDSLIVFHGLAEFYLANIHGLAPFRTFRVLRIFKLVKYWPTFKILMQ   620
XP_002685417.2     571   WNIYDSLIVFHGLAELYLTNFHGLAILRSFRVLRIFRLGRYWPTFKILML   620
NP_033161.2        570   WNIFDSILVVLELTEILLADVEGLAVLITVPLIFI-KLGKYGPPFKSLMR   618
NP_113874.1        591   WHIFDSILVVLGLTEMLLADIEEITVFILVPLIFI-KLGKYAPPFKNLMR   639


NP_002967.2        619   SLSNSWVALKDLVLLLFTFIFFSAAFGMKLFGKNYEEFVCHIDKDCQLPR   668
XP_515875.4        613   SLSNSWVALKDLILLLFTFIFFSAAFGMKLFGKNYEEFVCHIDKDCQLPR   662
XP_002808047.1     618   SLSNAWVTLRDLVLLLFIFMFFSAAFGMRLFGQNYEEFVCHIDQNCQLPR   667
XP_545504.3        621   ILNDSLVALKDLVLLLLTFTFFSAVVGLKLFGMNYKEGVCNIDKDCRLPH   670
XP_002685417.2     621   TLCNSIVALKDLVLLLFTFIFFSAVVGLNLYGSKYKKYVCSINEDCQLPH   670
NP_033161.2        619   ILGSSLMALKDLVLLLCIFVYFSAVFGMKLFGRSYKDCVCHIKEDCQPQR   668
NP_113874.1        640   ILGRALVALKDLVLLVSIFIYFSAVFGMKLFGRSYKDCVCHVDQDCQRQR   689


NP_002967.2        669   WHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNL   718
XP_515875.4        663   WHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNL   712
XP_002808047.1     668   WHMHDFFHSYLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNL   717
XP_545504.3        671   WHMQDFFHSYLNVFRILCGEWIETLWDCFKVAGQFSCIPFYMMVILIGNL   720
XP_002685417.2     671   WHMHDFFHSFLNVFRILCGEWIETLWDCFKVAGQFSCIPFYMMVILIGKL   720
NP_033161.2        669   WHMSDFLHAYMTVFRILCGEWIETLWECMEVAGQAWCIPFYMMVILIGNL   718
NP_113874.1        690   WHMSDFLHAYVTVFRILCGEWIETLWECMEVAGEAWCIPFYMMVILIGNL   739


NP_002967.2        719   LVLYLFLALVSSFSSCKDVTAEE-NNEAKNLQLAVARIKKGINYVLLKIL   767
XP_515875.4        713   LVLYLFLALVSSFSSCKDVTAEE-NNEAKNLQLAVARIKKGINYVLLKIL   761
XP_002808047.1     718   LVIYLFLALVSSFSSCKDVTAEE-NNEAKNLQLAVARIKKGINYVLLKIL   766
XP_545504.3        721   LIIYLFLALVSSFSSYKAATTEE-DDEAKNLQRAVAKIQKGINYVLSKIL   769
XP_002685417.2     721   LILYLFLALIISFSSYKPATTEEFSEEAKNLQRAMARIKKGINYLLSKIV   770
NP_033161.2        719   LILYLFVTLVSSFSYY-DATSEV-NKEAKNLQLAMARIKSGINSMLLKLM   766
NP_113874.1        740   LILYLFVGLVSSFASY-DATTEV-SKEAKNLQLAVAWIKMVINCVLLKIL   787


NP_002967.2        768   CKTQNVPKDTMDHVNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKN   817
XP_515875.4        762   CKTQNVPKDTMDHVNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKN   811
XP_002808047.1     767   CKKQNVPKDTMDHVNEVYVKEDISDHTLSELSNAQDFLKDKEKSSGTEKN   816
XP_545504.3        770   CKNQNVSKETMDNVNDVYVKENISDHTLSELSNTQEFLKDKEKSSGTEKN   819
XP_002685417.2     771   CKKQNVLEETMDNISDVYVKENISDHTLSELSNTQDFLKDKEKSSGTEKN   820
NP_033161.2        767   CTERSVPTEATDQICDPSVKENISGHTLSELSNTQTFLRYKDQSSSTEKT   816
NP_113874.1        788   CKEKTVSTEATDQTCDPSVKENISGHTLSELSNTQTFLRYKDQSSGTEKT   837


NP_002967.2        818   A-TENESQSLIPSPSVSETVPIASGESDIENLDNKEIQSKSGDGGSKEKI   866
XP_515875.4        812   A-TENESQSLIPSPSVSETVPIASGESDIENLDNKEIQSKSGDGGSKEKI   860
XP_002808047.1     817   T-TENESQSLIPSPSVSETVPVASGESDIENPDNKEIQSKSGDGDSKEKI   865
XP_545504.3        820   TLSENESQSLIPSPSVSETVPIASGESDIENLDNKEIQSKSGDGSSKEKV   869
XP_002685417.2     821   TMTENESQSLIPSPSVSETVPIASEESDIENPDNKEIQSKSGDGSSKEKV   870
NP_033161.2        817   PVTESESQSLIASPSASETVPIASGESDIENLDNKETRSKSGNGGSKEKM   866
NP_113874.1        838   PVTESESQSLIASPSVSETVPIASGESDIENLDNKETRSKSANGSSKEKM   887


NP_002967.2        867   KQSSSSECSTVDIAISEEEEMFYGGERSKHLKNGCRRGSSLGQISGASKK   916
XP_515875.4        861   KQSSSSECSTVDIAISEEEEMFYGGERSKHLKNGCRHGSSLGQISGASRK   910
XP_002808047.1     866   KQSSSSECSTVDIAISEEEEMFYGSERSKHPKNGCGRGSSLGQTSGASKK   915
XP_545504.3        870   KQSSSSECSTVDIAISEEEEMVYEHEKPKHLKNGYRQRSSPGQFSRVSRK   919
XP_002685417.2     871   KQSSSSECSTVDIVLS-EEEMVYECEKPKHLRNVYERRSSSAQIGRGPQK   919
NP_033161.2        867   KQSSSSECSTVDIAISEEEEMVYEHEKSKLHKNGYERKSSTGQISRESRN   916
NP_113874.1        888   KQSSSSECSTVDIAISEEEEMVYEHEKSKLHKNGYERKSSAGQVSRESRN   937


NP_002967.2        917   GKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQRKTIKI   966
XP_515875.4        911   GKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYIDQRKTIKI   960
XP_002808047.1     916   GKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGALAFEDIYIDQRKTIKI   965
XP_545504.3        920   GKIWQNIRKTCCKIVENSCFKCFIGLVTLLSTGALAFEDIYIDQRKTIKI   969
XP_002685417.2     920   GKIWKNIRKTCCKIVENNCFKCFIGLVTLLSTGALAFEDIYIDQRKTIKI   969
NP_033161.2        917   GKIWKNIRKTCCKIVENSWFECFIGLVTLLCTGTLALEDIYIDQRKTTKI   966
NP_113874.1        938   GKIWRNIRKTCCKIVENSWFECFIGLVTLLCTGTLALEDIYIHQRKTIKI   987


NP_002967.2        967   LLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSL-   1015
XP_515875.4        961   LLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSL-   1009
XP_002808047.1     966   LLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVRVLSLA   1015
XP_545504.3        970   LLEYADMIFTYIFILEMLLKWMAYGFKAYFTNGWYKLDFMVVIVFCLSL-   1018
XP_002685417.2     970   LLEYADMIFTYIFILEMLLKWMAYGFKAYFTNGWYKLDFMVVIVFCLSL-   1018
NP_033161.2        967   LLEYADMIFAYIFILEMLLKWVAYGFKAFFSNNWYKLDFMVVIVFCLSL-   1015
NP_113874.1        988   FLEYGDMIFAYIFILEMLLKWVAYGFKAYFSNNWYKLDFMVVIVLCLSL-   1036


NP_002967.2       1016   -IGKTREELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLV   1064
XP_515875.4       1010   -IGKTREELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLV   1058
XP_002808047.1    1016   XIGKTREELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLV   1065
XP_545504.3       1019   -IGKSREELKPLISIKFLRALRVLSQFERMKVVVRALIKTTLPTLNVFLV   1067
XP_002685417.2    1019   -IGKSREELKPLVSIKFLRALRVLSQFEKMKVVVRALIKTTLPTLNVFLV   1067
NP_033161.2       1016   -IGKTREDLNPLTSIKFLRALRVLSQFERMKVVLRALIKTTLPTVSVFLV   1064
NP_113874.1       1037   -KGKTREDLNPLPSIKFLRALRVLSQFERMKVVLRALIKTTLPAVSVFLV   1085


NP_002967.2       1065   CLMIWLIFSIMGVDLFAGRFYECIDPTSGERFPSSEVMNKSRCESLLFNE   1114
XP_515875.4       1059   CLMIWLIFSIMGVDLFAGRFYECVDPTSGERFPSSEVMNKSQCESLLFNE   1108
XP_002808047.1    1066   CLMIWLIFSIMGVDLFAGRFYECIDPTSGERFPSSEVMNKSQCESLLFNE   1115
XP_545504.3       1068   CFMIWLAFSILGVHLFAGTFYECIDPTSGERFPIAEVMNKSQCESLVFNE   1117
XP_002685417.2    1068   CLMIWLAFGIIGVHLFAGKFYECIDPTSGERFPLSEVMNRSQCESLVFNE   1117
NP_033161.2       1065   CLMIWLLFSVIGVQLFAGKFYECIDPTKGERFPVFEVMNKSQCEKLLFNE   1114
NP_113874.1       1086   CLMIWLLFSVMGVFLFAGKFYECIDPTRGERFSVFEVMNKSQCENLVFNE   1135


NP_002967.2       1115   SMLWENAKMNFDNVGNGFLSLLQVATFNGWITIMNSAIDSVAVNIQPHFE   1164
XP_515875.4       1109   SMLWENAKMNFDNVGNGFLSLLQVATFNGWITIMNSAIDSVAVNIQPHFE   1158
XP_002808047.1    1116   SMPWENAKMNFDNVGNGFLSLLQVATFNGWITIMNSAIDSVAVNIQPHFE   1165
XP_545504.3       1118   SMPWENAKLNFDNVGNGFLSLLQVATFNGWITIMNSAVDSIGVNRQPNFE   1167
XP_002685417.2    1118   SMPWENAKLNFDNVGISFLSLLQVATFNGWITIMNSAVDSTDVNMQPNFE   1167
NP_033161.2       1115   SMPWENAKLNFDNVGNGFLSLLQVATFNGWISIMNSAIDSVGVNMQPSFE   1164
NP_113874.1       1136   SMPWENAKLNFDNVGNGFLSLFQVATFNGWISIMNSAIDSVGVYMQPSFE   1185


NP_002967.2       1165   VNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHKIKLGGSNIFITVKQ   1214
XP_515875.4       1159   VNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHKIKLGGSNIFITVKQ   1208
XP_002808047.1    1166   VNIYMYCYFINFIIFGVFLPLSMLISVIIDNFNRHKIKLGGTNIFITVKQ   1215
XP_545504.3       1168   DNIYMYCYFINFVIIGLFLPLSMLIGVIIANFNKHNIKQGGSNIFITVKQ   1217
XP_002685417.2    1168   NNIYMYCYFIDFIIIGLFLPLSMLIGAIVANFHKHKIKQGGSNIFITVKQ   1217
NP_033161.2       1165   YNLYMYSYFIIFVIFGLFLPLCMLIGVIIRNFNKQKIKQGGSNIFITVKQ   1214
NP_113874.1       1186   HSLHMYTYFIIFVVFGLFLPLCMLIGVIIRNFNKQKIKQGGSNIFITVKQ   1235


NP_002967.2       1215   RKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVLICFQ   1264
XP_515875.4       1209   RKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQVFNVIVMVLICFQ   1258
XP_002808047.1    1216   RKQYRRLKKLMYEDSQRPVPRPRNKLQGFVFDLVTSQVFNVIVMVLICFQ   1265
XP_545504.3       1218   KKQSRALRRLLCEDSQKTLRRPGNKCQGFIFDLVTNDIFNAIIMVLICFQ   1267
XP_002685417.2    1218   KKQYRALKKLMYEDSQQPVPLPENKFQRFIFDLVTSRVFNIIIMTLICFQ   1267
NP_033161.2       1215   KKQYRALKKLLYADVQKPTPRPRNKFQGFLFDLVTHRVFNVIIILLICFQ   1264
NP_113874.1       1236   KKQYRALKKLLYADSQKPAARPRNKFQGFICDVVTHRVFNVVVVLLICFQ   1285


NP_002967.2       1265   AIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAW   1314
XP_515875.4       1259   AIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKIIAFRCFYFTIVW   1308
XP_002808047.1    1266   AIAMMIDTDGQSLEMYIALYWINSIFVMLYTMECILKLIALRCFYFTIVW   1315
XP_545504.3       1268   AITIMIQSDEQSQKMDAALCWINLVLIILYAGECVLKLIAFQCSYFTIGW   1317
XP_002685417.2    1268   AITIMIQSDEQSPKINTALFWINSVYVMLYIGECVLKLIVFHCNYFTSGW   1317
NP_033161.2       1265   ATTIMIQKDEQSPQMETAIFWMNSIFVMLFTLECILKLTAFRCHYFTSAW   1314
NP_113874.1       1286   ATTIMIQNDEQSPQIETAVFWMNSLFTMLFTLECILKLTAFRCHYFTSAW   1335


NP_002967.2       1315   NIFDFMVVIFSITGLCLPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPK   1364
XP_515875.4       1309   NIFDFMVVIFSITGLCLPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPK   1358
XP_002808047.1    1316   NIFDFMVVIFSITGLCLPMTVGSYLVSPSFEQLILLSRIIHMLRLGKGPK   1365
XP_545504.3       1318   NIFDFMVVIFSVTELFLPMMVGYYLVSPSIVELIRMSRIIHILRPGKGPK   1367
XP_002685417.2    1318   NIFDFMVVVFSITGLFLPLMVGYYLVSPSLVQLILLSRIIHILHPEKGLK   1367
NP_033161.2       1315   NVHDFMVVIFSITGLLLPLTIGQYFVPPSLVQLILLSRVIHILRPGKGPK   1364
NP_113874.1       1336   NVHDFMVVVFSITGLLLPLSIGQYFVPPSLVQLLLLSRIIHVLRPGKGPK   1385


NP_002967.2       1365   VFHNLMLPLMLSLPALLNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDV   1414
XP_515875.4       1359   VFHNLMLPLMLSLPALLNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDV   1408
XP_002808047.1    1366   VFHNLMLPLMLSLPALLNIILLIFLVMFIYAIFGMYNFAYVKKEAGINDV   1415
XP_545504.3       1368   VFHDLLLPLILSLPALLNISLLIFLVMFIYAIFGMYNFAYVKKEAGINDV   1417
XP_002685417.2    1368   LFHNLLLPLMLSLPALLNISLLIFLIMFIYAIFGMYNFAYVKKEAGIDDM   1417
NP_033161.2       1365   VFHDLMLPLILALPALLNISLLIFLVMFIYAIFGMYNFAYVKKEAGINDV   1414
NP_113874.1       1386   VFHDLMLPLMLSLPALLNIGLLIFLVMFIYAIFGMYNFAYVKKEAGINDV   1435


NP_002967.2       1415   SNFETFGNSMLCLFQVAIFAGWDGMLDAIFNSKWSDCDPDKINPGTQVRG   1464
XP_515875.4       1409   SNFETFGSSMLCLFQVAIFAGWDGMLDAIFNSKWSDCDPDKINPGTQVRG   1458
XP_002808047.1    1416   SNFETFGSSMLCLFQVAIFAGWDGMLDAIFNSKWSDCDPDKINPGTQVRG   1465
XP_545504.3       1418   SNFETFGSSMLCLFQVTIFAGWDGMLNAIFNSKWSDCDPDKINPGTQVRG   1467
XP_002685417.2    1418   SNFETFSSSMLCLFRVTIFAGWDGMLNAVFNSKWSDCDPNKINPGTQVRG   1467
NP_033161.2       1415   SNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQWSDCDPDKINPGTQVKG   1464
NP_113874.1       1436   SNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQWSDCDPDKINPGTQVRG   1485


NP_002967.2       1465   DCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLNIASKKKNKTLSEDD   1514
XP_515875.4       1459   DCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLNIASKKKNKTLSEDD   1508
XP_002808047.1    1466   DCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLNIASKKKNKTLSEDD   1515
XP_545504.3       1468   DCGNPSVGIIYFVSYIIISWLIIVNMYIVVVMEFLNIASKKKAKTLSEDD   1517
XP_002685417.2    1468   DCGNPFLGIIYFVSYILLTRLIIVNMYIVVVMEFLNIASKKKAKTLSEED   1517
NP_033161.2       1465   DCGSPSVGISYFVSYILISWLIIVNMYIVLIMEFLSIPSQKKSRTLSEDD   1514
NP_113874.1       1486   DCGSPSVGIFYFVSYILISWLIIVNMYVVLIMEFLSIPSKRKNRTLSEDD   1535


NP_002967.2       1515   FRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLIALDL   1564
XP_515875.4       1509   FRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLIALDL   1558
XP_002808047.1    1516   FRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLIALDL   1565
XP_545504.3       1518   FRKFFQVWEQFDPDKTQYIDSSMLSDFAAALDPPLFMAKPNKGQLVAMDL   1567
XP_002685417.2    1518   FRKFFQVWKRFDPERTQYIDSSKLSDFAAALDPPLFMAKPNKGQLVAMDL   1567
NP_033161.2       1515   FRRFFRVWNRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLVAMDL   1564
NP_113874.1       1536   FRRFFKVWNRFDPDRTQYIDSTKLSDFAAALDPPLFMAKPNKGQLVAMDL   1585


NP_002967.2       1565   PMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFKITCE   1614
XP_515875.4       1559   PMAVGDRIHCLDILLAFTKRVMGQDVRMEKVLSEIESGFLLANPFKITCE   1608
XP_002808047.1    1566   PMAVGDRIHCLDILLAFTKRVMGKDVRMEKLLSEIESGFLLANPFKITCE   1615
XP_545504.3       1568   PMAAGDRIHCLDILLALTKRVMGKDVKMEKIISEMESGFVLANPFKITYE   1617
XP_002685417.2    1568   PMAVGDRIHCLDVLLALTKRVLGKDLSMEKVLSEMESGLTLANTFKITYE   1617
NP_033161.2       1565   PMAAGDRIHCLDILLAFTKRVMGKDERVEKILSEIESGFMLANPFKITYE   1614
NP_113874.1       1586   PMAAGDRIHCLDILLAFTKRVMGKDERVEKILSEIESGFMLANPFKITYE   1635


NP_002967.2       1615   PITTTLKRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATK   1664
XP_515875.4       1609   PITTTLKRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATK   1658
XP_002808047.1    1616   PITTTLKRKQEAVSATIIQRAYKNYLLRRNDKNTSHIHMIDDDRDVHATK   1665
XP_545504.3       1618   PITTTLKRKQEAVSATIIQRAYKSYRLRQNDKNTSDIHMIDEDKEVQANT   1667
XP_002685417.2    1618   PITTTLKRKQEVVSATIIQRAYKSYRLRQNDKNTSDTHMIDGDREVQAIK   1667
NP_033161.2       1615   PITTTLKRKQEAVSATIIQRAYKSYRLRQNDKNVSDTPAIDDRRD-DLTS   1663
NP_113874.1       1636   PITTTLKRKQEAVSATIIQRAYKSYRLRQSDKKIQDIPEIDDGRE-DPNS   1684


NP_002967.2       1665   EGAYFDKAKEKSPIQSQI   1682
XP_515875.4       1659   EGAYFDKAKEKSPIQSQI   1676
XP_002808047.1    1666   EGAYFDKAKEKSPIQSQI   1683
XP_545504.3       1668   ENAYFDKAEEKSTIQSQI   1685
XP_002685417.2    1668   EDSYIDKAEGVSILQSQI   1685
NP_033161.2       1664   KGAHSGKIEEKASIQTQI   1681
NP_113874.1       1685   KGVHSGQIEEKASIQTQI   1702


Protein Acc. Gene Organism
NP_002967.2 SCN7A H.sapiens
XP_515875.4 SCN7A P.troglodytes
XP_002808047.1 SCN7A M.mulatta
XP_545504.3 SCN7A C.lupus
XP_002685417.2 SCN7A B.taurus
NP_033161.2 Scn7a M.musculus
NP_113874.1 Scn7a R.norvegicus


Support Center