Display Settings:

Format

Send to:

Choose Destination
HomoloGene:55599. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001715.1          1   MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNF   50
XP_001141002.1       1   MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNF   50
XP_001102701.1       1   MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNF   50
XP_005629661.1       1   MAKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNL   50
NP_001030479.1       1   MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSDGLQEARNCGKQLKALNF   50
NP_031589.1          1   MSKHKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNF   50
NP_955414.1          1   MSKHRLIILRHGEGQWNKENRFCSWVDQKLNSDGLEEARNCGRQLKALNF   50
NP_001025939.1       1   MTKYKLVLLRHGEGAWNKENRFCSWVDQKLSSDGIKEAQNCGRQLKALGF   50
NP_001002630.1       1   MSKYKLFLLRHGEGAWNKENRFCSWVDQKLSENGVVEAQECGRLLKENGY   50
NP_001016599.1       1   MSKYKLVMLRHGEGAWNIENRFCSWVDQKLSADGLREAEECGKKLKSLGF   50


NP_001715.1         51   EFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR   100
XP_001141002.1      51   EFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR   100
XP_001102701.1      51   EFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR   100
XP_005629661.1      51   EFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR   100
NP_001030479.1      51   EFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALISLNR   100
NP_031589.1         51   EFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR   100
NP_955414.1         51   EFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR   100
NP_001025939.1      51   EFDLVFTSILRRSIQTAWLVLEEMGQEWVPIQSSWRLNERHYGALIGLNR   100
NP_001002630.1      51   QLDQVFTSILSRSIHTAWLVLEAMGHEWVPVTKSWRLNERHYGALIGLNR   100
NP_001016599.1      51   EFDLVFTSILSRSIQTAWLVLRELDQEWVPIQSSWRLNERHYGALIGLNR   100


NP_001715.1        101   EQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLD   150
XP_001141002.1     101   EQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYHEIYNDRRYKVCDVPLD   150
XP_001102701.1     101   EQMALNHGEEQVRLWRRSYNITPPPIEESHPYYHEIYNDRRYKVCDVPLD   150
XP_005629661.1     101   EQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYHEIYNDRRYKVCDIPVD   150
NP_001030479.1     101   EQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYHEIYNDRKYKVCDVPLD   150
NP_031589.1        101   EKMALNHGEEQVRLWRRSYNVTPPPIEESHPYFHEIYSDRRYKVCDVPLD   150
NP_955414.1        101   EKMALNHGEEQVRLWRRSYNVTPPPIEESHPFFHEIYNDRRYKVCDVPLD   150
NP_001025939.1     101   AEMALNHGEEQVKIWRRSYDVTPPPITESHPYYEEIYNDRRYKCCDVSQD   150
NP_001002630.1     101   AEMALNHGEEQVKLWRRSYDITPPPIHESHPYYAEIYNDRRYSTCDVPKE   150
NP_001016599.1     101   AELALNHGEEQVKIWRRSYDVSPPPIDASHPYYQEIHTDRRYTTCDIPKE   150


NP_001715.1        151   QLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLE   200
XP_001141002.1     151   QLPRSESLKDVLERLLPYWNERIAPEVLHGKTILISAHGNSSRALLKHLE   200
XP_001102701.1     151   QLPRSESLKDVLERLLPYWNERIAPEVLRGKTVLISAHGNSSRALLKHLE   200
XP_005629661.1     151   QLPRSESLKDVLERLLPFWNERIAPEVLSGKTILISAHGNSSRALLKHLE   200
NP_001030479.1     151   QLPRSESLKDVLERLLPYWNERIAPEVLRGKTVLISAQGNSCRALLKYLE   200
NP_031589.1        151   QLPRSESLKDVLERLLPYWKERIAPEILKGKSILISAHGNSSRALLKHLE   200
NP_955414.1        151   QLPRSESLKDVLERLLPYWKERISPEILKGKTVLISAHGNSSRALLKHLE   200
NP_001025939.1     151   NLPKAESLKDVLDRLLPYWNEKIVPELKSGKKILISAHGNSSRALLKHLE   200
NP_001002630.1     151   ELPKTESLKEVLDRLLPYWNDVIVPVIKSGQTVLISAHGNSCRALLKHLE   200
NP_001016599.1     151   KLPKSESLKQVLERLLPYWNEVIAPEIKNGKRVLISAHGNSTRALLKHLE   200


NP_001715.1        201   GISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVED   250
XP_001141002.1     201   GISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVED   250
XP_001102701.1     201   GISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVED   250
XP_005629661.1     201   GISDEDIINITLPTGVPILLELDENLHAVGPHQFLGDQDAIQAAIKKIDD   250
NP_001030479.1     201   GISDEEIINITLPTGVPILLELDENLRTVGPHQFLGDQEAIQAAIKKVDD   250
NP_031589.1        201   GISDEDIINITLPTGVPILLELDENLRAVGPHQFLGNQEAIQAAIKKVDD   250
NP_955414.1        201   GISDEDIINITLPTGVPILLELDENLRAIRPHQFLGNQEAIQAAIKKVDD   250
NP_001025939.1     201   GISDKDIMNVTLPTGVPVLLELDENLRPLGPHQFLGDQEAIQAAIKKVED   250
NP_001002630.1     201   AISETDIVNVTLPTGVPVLLELDEDLRPVKPRQLLGDQAKIQAAIKKVED   250
NP_001016599.1     201   GISDSDIVNISLPTGVPVLLELDENLHPVKPHEFLGDQEAIRAAIKKVED   250


NP_001715.1        251   QGKVKQ-AKK   259
XP_001141002.1     251   QGKVKQ-AKK   259
XP_001102701.1     251   QGKVKQ-AKK   259
XP_005629661.1     251   QGKVKKRVEK   260
NP_001030479.1     251   QGKVKR-ADK   259
NP_031589.1        251   QGKVKQ-GKQ   259
NP_955414.1        251   QGKVRQ-NK-   258
NP_001025939.1     251   QGKVKS-AEK   259
NP_001002630.1     251   QGKVNA-QNK   259
NP_001016599.1     251   QGKVKP-NDN   259


Protein Acc. Gene Organism
NP_001715.1 BPGM H.sapiens
XP_001141002.1 BPGM P.troglodytes
XP_001102701.1 BPGM M.mulatta
XP_005629661.1 BPGM C.lupus
NP_001030479.1 BPGM B.taurus
NP_031589.1 Bpgm M.musculus
NP_955414.1 Bpgm R.norvegicus
NP_001025939.1 BPGM G.gallus
NP_001002630.1 bpgm D.rerio
NP_001016599.1 bpgm X.tropicalis


Support Center