Display Settings:

Format

Send to:

Choose Destination
HomoloGene:5225. Gene conserved in Tetrapoda Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001017926.1       1   MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTR-AESISSD   49
NP_001074953.1       1   MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTR-AESISSD   49
XP_001100237.1       1   MASRRKSTTPCMVLASEQDPDLELISDLEEGPPVLTPVENTR-AESISSD   49
XP_532322.1          1   MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTR-AESISSD   49
NP_001103565.1       1   MASRRKSTTPCMVLASEQDPDLELVSDLDEGPPVLTPIENTR-TESVSSD   49
NP_033598.2          1   MASRRKSTTPCMVLASEQDPDLELISDLDEGPPILTPVENAK-AESVSSD   49
NP_598304.1          1   MASRRKSTTPCMVLASEQDPDLELISDLEEGPPVLTPVENAR-AESVSSD   49
XP_418454.2          1   MASKRKSTTPCMVLANEQDPDLEMVSDLEEGPPVITPADNNPAAESIASE   50
XP_004915112.1       1   MASKRKSTTPCMVLASEPDPDLEINSDNEERSPHPTTAENPA-PESSSSE   49


NP_001017926.1      50   EEVHESVDSDNQQN-KKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   98
NP_001074953.1      50   EEVHESVDSDNQQN-KKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   98
XP_001100237.1      50   EEVNESVDSDNQQN-KKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   98
XP_532322.1         50   EEVHESVDSDNQQN-KKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   98
NP_001103565.1      50   EEVHESVDSDNQQN-KKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   98
NP_033598.2         50   EEVHGSVDSDNQQN-KKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   98
NP_598304.1         50   EEVHESVDSDNQQN-KKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   98
XP_418454.2         51   EDVHENVDSDNQKNTNKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVL   100
XP_004915112.1      50   DDTVEPNDSDNQQN-KTVEGGYECKYCSFQTPDLNMFTFHVDSEHPNVVL   98


NP_001017926.1      99   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTI   148
NP_001074953.1      99   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTI   148
XP_001100237.1      99   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTI   148
XP_532322.1         99   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTI   148
NP_001103565.1      99   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTI   148
NP_033598.2         99   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTI   148
NP_598304.1         99   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTI   148
XP_418454.2        101   NSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTV   150
XP_004915112.1      99   NSSYFCVECNFLTKRYDSLSEHNMKYHPGEDNFKLTMVKRNNQTIFEQTV   148


NP_001017926.1     149   NDLTFDGSFVKEENAEQAESTEVSSSGISISKTPIMKMMKNKVENKRIAV   198
NP_001074953.1     149   NDLTFDGSFIKEENAEQAESTEVSSSGISISKTPIMKMMKNKVENKRIAV   198
XP_001100237.1     149   NDLTFDGSFVKEENLEQAEPTEVSSSGISISKTPIMKMMKNKVENKRIAV   198
XP_532322.1        149   NDLTFDGSFVKEENSEQAEPTEVSSSGISISKTPIMKMMKNKVENKRITV   198
NP_001103565.1     149   NDLTFDGSFVKEENSEQAESTEVSSSGISISKTPIMKMMKNKVENKRITV   198
NP_033598.2        149   NDLTFDGSFVKEENTEQGESIDVSSSGISISKTPIMKMMKNKVENKRITV   198
NP_598304.1        149   NDLTFDGSFVKEENTEQGESIDVSSSGISISKTPIMKMMKNKVENKRITV   198
XP_418454.2        151   NDLTFDGSFVREENAEQADPSEAPSAGISISKTPIMKMMKNKTETKRIAV   200
XP_004915112.1     149   NDLTFDGSFVQEENQEQDEP---NSPGISISKTPIMKLMKDKSDKKRITV   195


NP_001017926.1     199   HHNSVEDVP-EEKENEIKPD-----REEIVENPSSSASESNTSTSIVNRI   242
NP_001074953.1     199   HHNSVEDVP-EEKENEIKPD-----REEIVENPSSSASESNTSTSIVNRI   242
XP_001100237.1     199   HHNSVEDVP-EEKENEIKPD-----REEIVENPSSSASESNTSTSIVNRI   242
XP_532322.1        199   HHNSVEDIP-EDKENEIKPD-----REETVENPSSSASESNTSTSIVNRI   242
NP_001103565.1     199   HRNSAEDIP-EEKENEIKPD-----REETVENPSSSASESNASTSVVNRI   242
NP_033598.2        199   HHNSAEGTS-EEKENGVKAS-----QEENAESVSSSALESNTSTSTINRV   242
NP_598304.1        199   HHNSAEGTS-EEKENGVKAS-----REENAENTSSSASESNTSTSTVNQV   242
XP_418454.2        201   FHNVVDDIPGEEKGKENEPS-----SEEVVENPPPAVSESKASHSVVCSA   245
XP_004915112.1     196   SQNAGDDSA-EDIDVKRESDQKVKLQEETEKKTPPLVSEPAKTVNNIITN   244


NP_001017926.1     243   HPSTASTVVTPAAVL-PGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNA   291
NP_001074953.1     243   HPSTASTVVTPAAVL-PGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNA   291
XP_001100237.1     243   HPSTASTVVTPAAVL-PGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNA   291
XP_532322.1        243   HPNTASTVMTPAAVL-PGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNA   291
NP_001103565.1     243   HPHAASTVVAPAAVL-PGLAQVITAVSAQQNSSLIPKVLIPVNSIPTYNA   291
NP_033598.2        243   HPSPASTVVTPTAVL-PGLAQVITAVSAQQNSNLLPKVLIPVNSIPTYNA   291
NP_598304.1        243   HPSPAGTVVTPTAVL-PGLAQVITAVSAQQNSNLVPKVLIPVNSIPTYNA   291
XP_418454.2        246   -ADVGSTVVTP-VIQ-PGVAQVITAVTAPQNSNLIPKVLIPVNSIPTYNT   292
XP_004915112.1     245   APELASTIVTPANVLQSGLAQVITAVQAQQNCNIVSKVLIPVNSIPSYNA   294


NP_001017926.1     292   ALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGV   341
NP_001074953.1     292   ALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGV   341
XP_001100237.1     292   ALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGV   341
XP_532322.1        292   ALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGV   341
NP_001103565.1     292   ALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGV   341
NP_033598.2        292   ALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGV   341
NP_598304.1        292   ALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGV   341
XP_418454.2        293   ALDNNPLLLNTYNKFPYPTMSEITVLSTQAKYTEEQIKIWFSAQRLKHGV   342
XP_004915112.1     295   AMDNNTLLHGAYNNFPYPTVSEIKLLTSQTKFTEEQVKIWFSAQRLKHGV   344


NP_001017926.1     342   SWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIV   391
NP_001074953.1     342   SWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIV   391
XP_001100237.1     342   SWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIV   391
XP_532322.1        342   SWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIV   391
NP_001103565.1     342   SWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISAGSNGLPSILQTCQIV   391
NP_033598.2        342   SWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIV   391
NP_598304.1        342   SWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIV   391
XP_418454.2        343   SWTPEEVEEARRKQFNGTVHTVPQTITVIPAHISAASSGLPSILQTCQIV   392
XP_004915112.1     345   SWTPEEVEEARRKQCNGTVHTVPQTITVIPAHLSTGANGLPSIFQTCQIV   394


NP_001017926.1     392   GQPGLVLTQVAGTNTLPVTAPIALTVAGVPSQNNIQKSQVPAAQPTAETK   441
NP_001074953.1     392   GQPGLVLTQVAGTNTLPVTAPIALTVAGVPSQNNIQKSQVPAAQPTAETK   441
XP_001100237.1     392   GQPGLVLTQVAGTNSLPVTAPIALTVAGVPSQNNVQKSQVPAAQPTAEAK   441
XP_532322.1        392   GQPGLVLTQVAGANPLPVTAPIALTVAGVPNQTNVQKSQAPAAQPIAETK   441
NP_001103565.1     392   GQPGLVLTQVGGTNTLPVTAPIALTVAGVPNQTNVQKSQVPTTQPTTETK   441
NP_033598.2        392   GQPGLVLTQVAGTNTLPVTAPIALTVAGVPNQTNVQKSQVPAAQPATDTK   441
NP_598304.1        392   GQPGLVLTQVAGANTLPVTAPIALTVAGVPNQTNVQKSQVPAAQPAAETK   441
XP_418454.2        393   GQPGLVLTQVAGTNTLPVTAPIALTVAGVPNQTQLQKSQIHTAQPIAETK   442
XP_004915112.1     395   GQPSLVLTQVAGTNALPVTTPIALAVAGVPNSAQLQKAPLATTQPIPETK   444


NP_001017926.1     442   PATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHD   491
NP_001074953.1     442   PATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHD   491
XP_001100237.1     442   PATAAVPASQSVKHETALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHD   491
XP_532322.1        442   PATAAIPPSQLVKHETTGANPDSFGIRAKKTKEQLAELKVSYLKNQFPHD   491
NP_001103565.1     442   PAIAAVPSAQLVKHEATLANPDSFGIRAKKTKEQLAELKVSYLKNQFPHD   491
NP_033598.2        442   PATAAVPSSPSVRPEAALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHD   491
NP_598304.1        442   PATAAVPSSPSVRPEAALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHD   491
XP_418454.2        443   Q-VAAVPAPQPIKNETALMNPDTFGMRAKKTKEQLAELKVSYLKNQFPQD   491
XP_004915112.1     445   R-VLTIPAPQIPKQEQTVIGID-FSMRSKKTKEQLTALKISYLKSQFPHN   492


NP_001017926.1     492   SEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIIID   541
NP_001074953.1     492   SEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIIID   541
XP_001100237.1     492   SEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIIID   541
XP_532322.1        492   SEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIIID   541
NP_001103565.1     492   AEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSATIIID   541
NP_033598.2        492   SEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSATIIID   541
NP_598304.1        492   SEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSATIIID   541
XP_418454.2        492   SEISRLMKITGLTKGEIKKWFSDTRYNQRNSKNNHGIHLNSDSCATIIID   541
XP_004915112.1     493   SEIERLIKLTGLTKGEIKKWFSDTRYNQRNSKGSHGIHFTSDGGG-IIFD   541


NP_001017926.1     542   SSDETTESPTVGTA--QPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLN   589
NP_001074953.1     542   SSDETTESPTVGTA--QPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLN   589
XP_001100237.1     542   SSDETTESPSVGTA--QPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLN   589
XP_532322.1        542   SSDETTESPTVVTS--QPKQSWNPFPDFTPQKFKEKTAEQLRALQASFLN   589
NP_001103565.1     542   SSDETTESPAVVTS--QQKQSWNPFPDFTPQKFKEKTAEQLRALQASFLN   589
NP_033598.2        542   SSDETPEPPAAAAS--QQKQSWNPFPDFAPQKFKEKTAEQLRALQASFLN   589
NP_598304.1        542   SSDETPEPPAAAAS--QPKQSWNPFPDFAPQKFKEKTAEQLRVLQASFLN   589
XP_418454.2        542   SSDEMNESPTGVVP--QNKSSWSAFPDFTPQKFKEKTAEQLQVLQASFLN   589
XP_004915112.1     542   SGDETIDSPTLVPPPQRSRQTWNPFPDFTPQKFKEKTAEQLDALEESFLK   591


NP_001017926.1     590   SSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGS   639
NP_001074953.1     590   SSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGS   639
XP_001100237.1     590   SSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGS   639
XP_532322.1        590   SSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEVDENNAGS   639
NP_001103565.1     590   SSVLTEEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKVEVEESNAGS   639
NP_033598.2        590   SSVLTDEEVNRLRAQTKLTRREIDAWFTEKNKTKALKDEKIEVDESNVGS   639
NP_598304.1        590   SSVLTDEELNRLRAQTKLTRREIDAWFTEKNKTKALKDEKVEVDESNVGS   639
XP_418454.2        590   NPILTDEEMNRLRAQTKLTRREIDAWFTERRKSNVLKEEGTEMNESNASS   639
XP_004915112.1     592   NSVPTDEELNKLRVQTKLTRREVDAWFSEKRRSTGIKEEASDLNESNAGL   641


NP_001017926.1     640   SKEEAGETSPAD-ESGAPKSGSTG--KICKKTPEQLHMLKSAFVRTQWPS   686
NP_001074953.1     640   SKEEAGETSPGD-ESGAPKSGSTG--KICKKTPEQLHMLKSAFVRTQWPS   686
XP_001100237.1     640   SKEEAGETSPGD-ESGAPKSGSTG--KICKKTPEQLHMLKSAFVRTQWPS   686
XP_532322.1        640   SKEEPGETSPRD-ESGAPKPGNTG--KICKKTPEQLHMLKSAFVRTQWPS   686
NP_001103565.1     640   SKEEAGETSPGD-ETSAPKSGSTG--KICKKTPEQLHMLKSAFVRTQWPS   686
NP_033598.2        640   SKEEPGESSPGD-ETVAPKSGGTG--KICKKTPEQLHMLKSAFVRTQWPS   686
NP_598304.1        640   SKEEPGENSPGD-EAVAPKSAGTG--KICKKTPEQLHMLKSAFVRTQWPS   686
XP_418454.2        640   SKEEAGETSAGD-GAAGSKSGGSGSSKIGKKSPEQLHMLKSSFVRTQWPS   688
XP_004915112.1     642   SIKEEVDANFGESDALGNKSGAMFPAKLGKKSPEQLHMLKNAFVHSQWPS   691


NP_001017926.1     687   PEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNG   736
NP_001074953.1     687   PEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNG   736
XP_001100237.1     687   PEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNG   736
XP_532322.1        687   PEEYDKLAEESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNG   736
NP_001103565.1     687   PEEYDKLAEESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNG   736
NP_033598.2        687   AEEYDKLAEESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSSNSSSLNG   736
NP_598304.1        687   PEEYDKLAEESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSSNSSSLNG   736
XP_418454.2        689   PQEYNKLAEETGLPRSEIVSWFGDTRYAWKNGGLKWYYYYQSANANSLNG   738
XP_004915112.1     692   SAEYDKLADQTGLARSDIVAWFGDTRYACKHNNLKWFYQYQGQNQNIMNG   741


NP_001017926.1     737   LSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKTGTAILK   786
NP_001074953.1     737   LSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKTGTAILK   786
XP_001100237.1     737   LSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKTGTAILK   786
XP_532322.1        737   LSSLRKRGRGRPKGRGRGRPRGRPRGSKRMNNWDRGPSLIKFKTGTAILK   786
NP_001103565.1     737   LSSLRKRGRGRPKGRGRGRPRGRPRGGKRMNNWDRGPSLIKFKTGTAILK   786
NP_033598.2        737   LSSLRRRGRGRPKGRGRGRPRGRPRGGKRMNTWDRVPSLIKFKTGTAILK   786
NP_598304.1        737   LSSLRKRGRGRPKGRGRGRPRGRPRGGKRMNTWDRVPSLIKFKTGTAILK   786
XP_418454.2        739   QGFARRRGRGRPKGRGRGRPRGRPRGSKRLNCWDRGVSVIKFKTGTAILK   788
XP_004915112.1     742   QTSTRKRGRGRPRGRGRGRPRGRPKGPRRTNNWER-VTVPKHKTGKALLK   790


NP_001017926.1     787   DYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELF-EEN   835
NP_001074953.1     787   DYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELF-EEN   835
XP_001100237.1     787   DYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELF-EEN   835
XP_532322.1        787   DYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGMELF-EEN   835
NP_001103565.1     787   DYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGIELF-EEN   835
NP_033598.2        787   DYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGIELF-EEN   835
NP_598304.1        787   DYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGIELF-EEN   835
XP_418454.2        789   DYYMKHKFLNEQDLDELVAKSHMGYEQVREWFAERQRRLELGIELF-EEN   837
XP_004915112.1     791   DYYGTHKFLNEEDLDELVSKSRMGYEQVREWFAERHQREDAGLDPFDEEE   840


NP_001017926.1     836   EEEDEVIDDQEEDEE--ETDDSDTWEPPRHVKRKLSKSDD   873
NP_001074953.1     836   EEEDEVIDDQEEDEE--ETDDSDTWEPPRHVKRKLSKSDD   873
XP_001100237.1     836   EEEDEVIDDQEEDEE--ETDDSDTWEPPRHVKRKLSKSDD   873
XP_532322.1        836   EEEDEVIDDQEEDEE--ETDDSDTWEPPRHVKRKLSKSDD   873
NP_001103565.1     836   EEEDEVIDDQEEEEE--ETDDSDTWEPPRHVKRKLSKSDD   873
NP_033598.2        836   EEEDEVVDDQEEDEE--ETDDSDTWEPPRHVKRKLSKSDD   873
NP_598304.1        836   EEEDEVIDDQEEDEE--ETDDSDTWEPPRHVKRKLSKSDD   873
XP_418454.2        838   EEEDEMLEEQ-EDEE--ETDDSDTWEPPRHVKRKLSKSD-   873
XP_004915112.1     841   EDEDDFLDDQDDEEENGDTDDSDTWEPPRHVRRRLSKRDD   880


Protein Acc. Gene Organism
NP_001017926.1 ZHX1 H.sapiens
NP_001074953.1 ZHX1 P.troglodytes
XP_001100237.1 ZHX1 M.mulatta
XP_532322.1 ZHX1 C.lupus
NP_001103565.1 ZHX1 B.taurus
NP_033598.2 Zhx1 M.musculus
NP_598304.1 Zhx1 R.norvegicus
XP_418454.2 ZHX1 G.gallus
XP_004915112.1 zhx1 X.tropicalis


Support Center