Display Settings:

Format

Send to:

Choose Destination
HomoloGene:495. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000584.2          1   MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRP   50
XP_001166911.2       1   MAELLASAASACSWDFPRAPPSFPPSAASRGGLGGTQSFRPHRGAESPRP   50
XP_001115506.1       1   MAALLASAGSDCSWDFPRAPPSLPPPAASRGGLRGAQSLRPRRSTESPRA   50
XP_005627251.1           --------------------------------------------------
NP_001091527.1           --------------------------------------------------
NP_038711.2              --------------------------------------------------
NP_114444.2              --------------------------------------------------
NP_001129440.1           --------------------------------------------------
XP_002665053.1           --------------------------------------------------
XP_002942646.1           --------------------------------------------------


NP_000584.2         51   GRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTV-LLLLADWVLLRTA   99
XP_001166911.2      51   GRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTV-LLFLADWVLLRTA   99
XP_001115506.1      51   GRDLNGVGVPMASSRCPAPRGCRCLPGASLAWLGTV-LLLLTDWLLLRTA   99
XP_005627251.1       1   ----------MAGSGPPSPGGRPCAPRARLAWLGVA-LLLLADWALLGRC   39
NP_001091527.1       1   ----------MACSGSPVPRGRPRLPRAAVGWLGTA-LLLLADWMLLRPA   39
NP_038711.2          1   --------------------------MAAHVWLAAA-LLLLVDWLLLRPM   23
NP_114444.2          1   --------------------------MAAHAWPTAALLLLLVDWLLLRPV   24
NP_001129440.1           --------------------------------------------------
XP_002665053.1       1   --------------------MKDKMAVPLFVLLALC-----VDVCAV-LS   24
XP_002942646.1       1   ----------------------------MHHIWTLC-FLFAVDFASM-LI   20


NP_000584.2        100   LPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGA   149
XP_001166911.2     100   LPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGA   149
XP_001115506.1     100   LPRIFSLLVPTALPLLQVWAVGLSRWAVLWLGACGVLRATVGSKSENAGA   149
XP_005627251.1      40   SPAVCSVLVPTAPPLLPAWVVGLSRAAVLWLGARGVLEAAVGSGSESAGL   89
NP_001091527.1      40   LPRVASRLVPPELPLLRVWVAGLSRCALLWLGARGVVGAALGFRRESTRV   89
NP_038711.2         24   LPGIFSLLVP-EVPLLRVWVVGLSRWAILGLGVRGVLGVT-------AGA   65
NP_114444.2         25   LPGIFSLLVP-EVPLLRVWAVGLSRWAILGLGVRGVLGVT-------AGA   66
NP_001129440.1       1   ---------------------------------MGTMGAG----------   7
XP_002665053.1      25   IGAIQLSPSFINNSFILLWLGGLIRTCLL---LFISFSYS--------GS   63
XP_002942646.1      21   LRLFLTYLLPIYAPIILAWLAGLVRFVILSLGICTVRSRS--------KL   62


NP_000584.2        150   QGWLAALK--PLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHP   197
XP_001166911.2     150   QGWLAALE--PLAAALGLALPVLALFRELISWGAPGSADSTRLLHWGSHP   197
XP_001115506.1     150   QGWLAALE--PLAAALGLALPGLALFRELISWGAPGAADSTRLLHWGSHP   197
XP_005627251.1      90   GGWLAALQ--PAAAALGLALPGLALFRELRSWRAPRDSDSPRLLHWGSRL   137
NP_001091527.1      90   LGWLAVLE--PLAAALGLALPGLALFRELVSWRAPEDADSAGHLHWEGRL   137
NP_038711.2         66   HGWLAALQ--PLVAALSLALPGLALFRELAAWGTLREGDSAGLLYWNSRP   113
NP_114444.2         67   RGWLAALQ--PLVAALGLALPGLASFRKLSAWGALREGDNAGLLHWNSRL   114
NP_001129440.1           --------------------------------------------------
XP_002665053.1      64   PAWMRGLEGVQTAVIHGLLYPVYISFLWAYGW-S-----TVELVWGWHSW   107
XP_002942646.1      63   PPWLQGDHLALIGTVLSFLVPFCAAVIALVSLRS-----STELLYSWSRW   107


NP_000584.2        198   TAFVVSYAAALPAAALWHKLGSLWVPGGQGG-----SGNPVRRLLGCLGS   242
XP_001166911.2     198   SAFVVSYAAALPAAALWHKLGSLWVPGGQGG-----SGDSVRRLLGCLGS   242
XP_001115506.1     198   SAFVVSYAAALPAAALWHKLGSLWVTGGQGV-----SGDPVRRLLGCLGS   242
XP_005627251.1     138   DVFALSYLAALSAAALWHKLSGLWAPGRRGG-----SGDAVRRLLGCLGS   182
NP_001091527.1     138   DAFAFSYWAALPAATLWYKIRSLWVQGARGA-----FGLAMSRLLVFLGP   182
NP_038711.2        114   DAFAISYVAALPAAALWHKLGSLWAPSGNRD-----AGDMLCRMLGFLGP   158
NP_114444.2        115   DAFVLSYVAALPAAALWHKLGGFWAPSGHKG-----AGDMLCRMLGFLDS   159
NP_001129440.1       8   -----------------------------------------RRLLLSLSP   16
XP_002665053.1     108   QGLVQGYFVLGLSLLIWKRHVPTILLTAKKERTEKKGKASLQRLLGYMKP   157
XP_002942646.1     108   DVFLLCYLLTVTSGILWHQLFP----HSTKEKIAVTSSASLRRLITLLQP   153


NP_000584.2        243   ETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMS   292
XP_001166911.2     243   ETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMS   292
XP_001115506.1     243   EMRRLSLFLVLVILSSLGEMAIPFFTGRITDWILQDGSADTFTRNLTLMS   292
XP_005627251.1     183   EMRRLPLLLALLVLSSLGEMAIPFFTGHLTDWILQDETASAFTRNITLMS   232
NP_001091527.1     183   EKSHVQFILALVFLSCFGEMAIPFFTGRLTDWIVQDETAAAFTQNVTLMS   232
NP_038711.2        159   KKRRLYLVLVLLILSCLGEMAIPFFTGRITDWILQDKTVPSFTRNIWLMS   208
NP_114444.2        160   KKGRLHLVLVLLILSCLGEMAIPFFTGRITDWILQDKTAPSFARNMWLMC   209
NP_001129440.1      17   ERRRCAAVMGLMAASALGEMAVPYYMGRASDWVAREDKLAA----ILPMV   62
XP_002665053.1     158   FSGRFAAVFFFVVISSLGEMAIPHYTGKMTDWIMNEDEPEAFNHAITVMT   207
XP_002942646.1     154   YVHRFLLVAVFLVLSSWSEMALPSYTGRMTDWIANKEDPSAFTSAIIAMS   203


NP_000584.2        293   ILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTG   342
XP_001166911.2     293   ILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTG   342
XP_001115506.1     293   ILTIASAVLEFMGDGIYNTTMGHVHSHLQGEVFGAVLRQETEFFQQNQTG   342
XP_005627251.1     233   ILTTTSAVLEFLGDGVYNSIMGRVHSQVQGEVFQAVLRQETEFFQQNQTA   282
NP_001091527.1     233   VLTIASAVLEFAADGIYNSTMGRVHSHLQGEVFQAVLRQETEFFQKNQTG   282
NP_038711.2        209   ILTIASTALEFASDGIYNITMGHMHGRVHREVFRAVLRQETGFFLKNPAG   258
NP_114444.2        210   ILTVASTALEFAGDGIYNITMGHMHSRVHGEVFRAVLHQETGFFLKNPTG   259
NP_001129440.1      63   LLGLSSAVTELVCDVTFVGTLSRTQSRLQRRVFAAVLRQSITELRADGAG   112
XP_002665053.1     208   LMTIMSAVCEFVCDLIYNITMSRIHTSIQGLVFQAVLKQDIAFFDKATTG   257
XP_002942646.1     204   LITAASAVTEFVCDCIYNVTMSMIHTHTQGQVLRSVLKQEMAFFDSESTG   253


NP_000584.2        343   NIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTL   392
XP_001166911.2     343   NITSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTL   392
XP_001115506.1     343   NITSRVTEDTSTLSDALSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTL   392
XP_005627251.1     283   -ITSRVTEDTSTLSESLSEKLSLLLWYLVRGLCLLGLMLWESLSLTMVTV   331
NP_001091527.1     283   EITSRVTDDTSTMSESLSSDLSLLLWYLIRGLCLLGLMLWASPSLTMITL   332
NP_038711.2        259   SITSRVTEDTANVCESISGTLSLLLWYLGRALCLLVFMFWGSPYLTLVTL   308
NP_114444.2        260   SITSRVTEDTSNVCESISDKLNLFLWYLGRGLCLLAFMIWGSFYLTVVTL   309
NP_001129440.1     113   DVAMRVTRDAEDVREALGKALSLLLWYLARGLCLFATMAWLSPRMALLTA   162
XP_002665053.1     258   DIVSRITTDTNTMSESLSEKLSLLMWYFMRVIFLFGSMLMLSTRLCCFTL   307
XP_002942646.1     254   DITSRVTTDTITMSESLSHELSLLMWYLMRVVFLSSYMIMLSPKLTFFTI   303


NP_000584.2        393   ITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFAN   442
XP_001166911.2     393   VTLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFAN   442
XP_001115506.1     393   VTLPLLFLLPKKVGKWYQLLAVQVQESLAKSSQVAIEALSAMPTVRSFAN   442
XP_005627251.1     332   VTLPLLFLLPEKLGRWHQVLATQVQTSLAESSQVAIEVLSAMPTVRSFAN   381
NP_001091527.1     333   VALPLLFLLPEKMGKWYKVLAEQVQESLAKSSQVAIEVLSAMPTVRSFAN   382
NP_038711.2        309   INLPLLFLLPKKLGKVHQSLAVKVQESLAKSTQVALEALSAMPTVRSFAN   358
NP_114444.2        310   LSLPLLFLLPRRLGKVYQSLAVKVQESLAKSTQVALEALSAMPTVRSFAN   359
NP_001129440.1     163   LALPLLLALPRAVGHFRQALAPQMQKAQARASEVAVETFQAMATVRSFAN   212
XP_002665053.1     308   LGLPVIWIIPEIFGRFYQKLSAQVQDSLAKANEVATETFSSMKTVRSFAN   357
XP_002942646.1     304   LCLCVITIVPKLTGTFSEGMAVRVQESLSKANQVALETFSNMKTVRSFAN   353


NP_000584.2        443   EEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQ   492
XP_001166911.2     443   EEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQ   492
XP_001115506.1     443   EEGEVQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQ   492
XP_005627251.1     382   EECEAQKFSQKLQKMNTLHQKEALAYAVNLWITSISGMLLKVGILYIGGQ   431
NP_001091527.1     383   EEGEAQKLRQKLHEMMVLNQKEALATRSTS-GPPLSGMLLKVGILYFGGQ   431
NP_038711.2        359   EEGEAQKFRQKLEEMKTLNKKEALAYVAEVWTTSVSGMLLKVGILYLGGQ   408
NP_114444.2        360   EEGEAQKFRQKLEEMKPLNKKEALAYVTEVWTMSVSGMLLKVGILYLGGQ   409
NP_001129440.1     213   EDGAAAHYRQRLQQSHRLEKKDVALYTASLWTSGFSALALKMGILYYGGQ   262
XP_002665053.1     358   EDGETERYRKCLEDTFALNKVEAAAYAVSTWTNSMSSLALKVSILYYGGR   407
XP_002942646.1     354   EEGECQRYEQRLHDTYQLNKVEAVAYGCSMVATSFSGLVLKVAILYFGGR   403


NP_000584.2        493   LVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYL   542
XP_001166911.2     493   LVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYL   542
XP_001115506.1     493   LVTSGAVSSGNLVTFVLYQMQFTVAVEVLLSVYPRVQKAVGSSEKIFEYL   542
XP_005627251.1     432   LVTNGTISSGSLVTFILYQIQFTSAVEALFSTYPSVQKAVGSSKEIFEYL   481
NP_001091527.1     432   LVTSGSVSSGRLVTFILYQIQFTIAVEVLLSRYPRVQKAVGFSEKIFEYL   481
NP_038711.2        409   LVIRGAVSSGNLVSFVLYQLQFTQAVQVLLSLYPSMQKAVGSSEKIFEYL   458
NP_114444.2        410   LVVRGAVSSGNLVSFVLYQLQFTRAVEVLLSIYPSMQKSVGASEKIFEYL   459
NP_001129440.1     263   LVAAGTVSTGDLVTFLLYQIQFTDVLRVLLDYFPTLMKAVGSSEKIFEFL   312
XP_002665053.1     408   LVTGSDVSSGDLVSFVLYELQFTSAVEVLMSYWPHVKKAVGASEKIFEYV   457
XP_002942646.1     404   LVTNGEVSGGELVSFVLYELQFSSAVEVLLRMYPEVRKAVGSSEKVFEYM   453


NP_000584.2        543   DRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGE   592
XP_001166911.2     543   DRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGE   592
XP_001115506.1     543   DRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGE   592
XP_005627251.1     482   GRIPRCPASGVLTSLNLEGLVQFQDVSFAYPNHPDVPVLQALTFTLRPGE   531
NP_001091527.1     482   DRVPNCPKSGSLASLTLRGSVQFQDVSFAYPNRPDVPVLQGLTFTLRPGE   531
NP_038711.2        459   DRTPCSPLSGSLAPSNMKGLVEFQDVSFAYPNQPKVQVLQGLTFTLHPGT   508
NP_114444.2        460   DRTPCSPLSGSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGK   509
NP_001129440.1     313   DREPQVAPSGTMAPADLQGHLQLEDVWFSYPGRQE-PVLKGVSLELRPGE   361
XP_002665053.1     458   DRKPDVPPDGSLAPKTLKGHVQFRNVTFAYPKRPDTDVLKNVSLELKAGK   507
XP_002942646.1     454   DRKPQSPSPGSFSPQDLKGIIQFQNVTFSYPTRPDSLALQDVSFKLHPGE   503


NP_000584.2        593   VTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVA   642
XP_001166911.2     593   VTALVGPNGSGKSTVAALLQNLYQPTEGQLLLDGKPLPQYEHRYLHRQVA   642
XP_001115506.1     593   VTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHKQVA   642
XP_005627251.1     532   VIALVGRNGSGKSTVAALLQNLYQPTKGQLLLDGEPLPQYEHRYLHTQVA   581
NP_001091527.1     532   VTALVGPNGSGKSTVAALLQNLYQPTEGQVLLDGEPLPKYEHRYLHRQVA   581
NP_038711.2        509   VTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGQCLVQYDHHYLHTQVA   558
NP_114444.2        510   VTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGELLVQYDHHYLHTQVA   559
NP_001129440.1     362   VLALLGPPGAGKSTLVALVSRLHQPTAGRLLLDGHPLPAYQHSYLCRQVA   411
XP_002665053.1     508   ITALVGPSGSGKTTVVSLLERFYQPQNGEILLDQKPLLSYKDQYLHEKIS   557
XP_002942646.1     504   VTALVGPCDAGKSTVVQLLLRLYQPQKGEILLDEKCINLYKNEYYRNKVS   553


NP_000584.2        643   AVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGY   692
XP_001166911.2     643   AVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGY   692
XP_001115506.1     643   AVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPRGY   692
XP_005627251.1     582   AVRQEPQLFGRSFRENIAYGLVQKPTMEEVIAAAMVSGAHSFISELPQGY   631
NP_001091527.1     582   AVGQEPLLFGRSFKENIAYGLVQEPTMEEITAAAVESGAHGFISELSEGY   631
NP_038711.2        559   AVGQEPLLFGRSFRENIAYGLNRTPTMEEITAVAVESGAHDFISGFPQGY   608
NP_114444.2        560   AVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGY   609
NP_001129440.1     412   VVPQEPLLFARSLHANISYGLGGC-SRAQVTAAARRVGAHDFITRLPQGY   460
XP_002665053.1     558   VVSQEPVLFARSVRENIKYGKENA-TNEEIYAAARLANAHDFISSLPKGY   606
XP_002942646.1     554   VVSQEPTLSARSLQDNIAYGMGEV-SLEYVKEAAQTAHAHDFISEMANGY   602


NP_000584.2        693   DTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVE   742
XP_001166911.2     693   DTEVGEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVE   742
XP_001115506.1     693   DTEVGEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLRVE   742
XP_005627251.1     632   DTEVGEAGSQLSGGQRQAVALARALIRKPRVLILDDATSALDANSQLRVK   681
NP_001091527.1     632   DTEVGEAGSQLSGGQRQAVALARALIRKPRVLILDDATSALDANSQSLVE   681
NP_038711.2        609   DTEVGETGNQLSGGQRQAVALARALIRKPLLLILDDATSALDAGNQLRVQ   658
NP_114444.2        610   DTEVGETGNQLSGGQRQAVALARALIRKPRLLILDDATSALDAGNQLRVQ   659
NP_001129440.1     461   DTEVGELGGQLSGGQRQAVAIARALLRDPRILILDEHTSALDTESQQQVE   510
XP_002665053.1     607   DTDAGEKGGQVSGGQKQRIAIARALIQKPQILVLDDATSSLDTESEHRVY   656
XP_002942646.1     603   QTGAGQKGGLLSGGQKQRVALARALLRNPKILILDDATSSLDLESEQKVQ   652


NP_000584.2        743   QLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK   792
XP_001166911.2     743   QLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK   792
XP_001115506.1     743   QLLYESPERYSRSVLLITQNLSLVEQADHILFLEGGTIREGGTHQQLMEK   792
XP_005627251.1     682   QLLYKSPERRFRSVLLITHCLSLLEQADQILFLEGGTICEAGTYRQLMER   731
NP_001091527.1     682   RLLYESPERGSRSVLFITQRLSSVEQADHILFLEGGTIIEAGTHQQLMTN   731
NP_038711.2        659   RLLYESPKRASRTVLLITQQLSLAEQAHHILFLREGSVGEQGTHLQLMKR   708
NP_114444.2        660   RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMER   709
NP_001129440.1     511   QEIL-AAKGSGRAVLMVTGRAALAARAQRVVVLEGGEVRQEGPPHEVLRP   559
XP_002665053.1     657   SALKKELQ--SCTVLLISHRLSGVENADHILFLREGELVEEGNHQQLLDK   704
XP_002942646.1     653   CAVYDGPR--DRTVLLISHRISTVQRADRILVLEGGRITEEGTHEQLLKQ   700


NP_000584.2        793   KGCY--WAMVQAPA-------DA--PE   808
XP_001166911.2     793   KGCY--WAMVQAPA-------DA--PE   808
XP_001115506.1     793   KGCY--WAMVQAPA-------DA--PE   808
XP_005627251.1     732   RGCF--WTMMQAPG-------GSGVPE   749
NP_001091527.1     732   EGRY--WAMVQAPG-------GPGAPE   749
NP_038711.2        709   GGCY--RAMVEALA-------AP--AD   724
NP_114444.2        710   GGCY--RSMVEALA-------AP--SD   725
NP_001129440.1     560   GSLLRDWGQQGAPGE---GDRGSGGEG   583
XP_002665053.1     705   QGFYAEFVKQQNTAIHRNADNGTNSSQ   731
XP_002942646.1     701   EGSYTRLWQKQLSSF-QSVNGEQLSSQ   726


Protein Acc. Gene Organism
NP_000584.2 TAP1 H.sapiens
XP_001166911.2 TAP1 P.troglodytes
XP_001115506.1 TAP1 M.mulatta
XP_005627251.1 TAP1 C.lupus
NP_001091527.1 TAP1 B.taurus
NP_038711.2 Tap1 M.musculus
NP_114444.2 Tap1 R.norvegicus
NP_001129440.1 TAP1 G.gallus
XP_002665053.1 tap1 D.rerio
XP_002942646.1 LOC100488534 X.tropicalis


Support Center