Display Settings:

Format

Send to:

Choose Destination
HomoloGene:48052. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001864.1          1   MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDG-I   49
NP_001092029.1       1   MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDG-I   49
XP_001097378.2       1   MAGRGGRALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDG-I   49
XP_005629450.1           --------------------------------------------------
NP_776328.2          1   MARRGGCALLVLCGSLAACAWLLGAEARGPGGPVAGARRRRR-PQEDG-I   48
NP_038522.2          1   MAGRGGRVLLALCAALVAGGWLLTAEAQEPGAPAAGMRRRRRLQQEDG-I   49
NP_037260.1          1   MAGRGGRVLLALCAALVAGGWLLAAEAQEPGAPAAGMRRRRRLQQEDG-I   49
XP_420392.3          1   MAARELRLLL-----LALGALLVACRAAEPAA--GGSSRRRRLSAEEG-I   42
NP_999975.1          1   ------MRAAVFCGAVLM----------------LALSSVKEAEGENG-I   27
NP_501935.1          1   MLHAMRPVLLVAALLAVTAHAFLG----------FGSGSTHKDDAEWG--   38
NP_001106417.1       1   MAG----VWASLCLSVLV---LLGCS--------SSLARGRRLSREPGDI   35


NP_001864.1         50   SFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGV   99
NP_001092029.1      50   SFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGV   99
XP_001097378.2      50   SFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGV   99
XP_005629450.1           --------------------------------------------------
NP_776328.2         49   SFEYHRYPELREALVSVWLQCAAVSRIYTVGRSFEGRELLVLELSDNPGV   98
NP_038522.2         50   SFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGV   99
NP_037260.1         50   SFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGV   99
XP_420392.3         43   SFEYHRYAELREALVAVWLQCPAISRIYTVGRSSEGRELLVIEVSDRPGE   92
NP_999975.1         28   SFEYHRYEEMRKSLVSVWLQCPSITRIYTVGESFEGRELLVLEMSDNPGI   77
NP_501935.1         39   --HYHNQAQLEAKLGEINEKCPEITTLYEIGQSVEGRPLVVIQFSTTPGE   86
NP_001106417.1      36   SYEYHRYPEMRDALVAVWLQCPSISRIYTVGRSFEGRELLVIEISDNPGE   85


NP_001864.1        100   HEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHST   149
NP_001092029.1     100   HEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHST   149
XP_001097378.2     100   HEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHST   149
XP_005629450.1       1   -------------MHGNEAVGRELLIFLAQYLCNEYQKGNETIVKLIHST   37
NP_776328.2         99   HEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVQLIHNT   148
NP_038522.2        100   HEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHST   149
NP_037260.1        100   HEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQRGNETIVNLIHST   149
XP_420392.3         93   HEPGEPEFKYVGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIINLIHST   142
NP_999975.1         78   HEPGEPEFKYIGNMHGNEAVGRELLIYLAQYLCNEYQEGNDTIIDLIHST   127
NP_501935.1         87   HIPTKPEVKLIGNMHGNEPIGRELLLRFAETLCNGAINNDKEIVQLLNST   136
NP_001106417.1      86   HEPGEPEFKYVGNMHGNEAVGRELLLYFAQYLCNEYQRENETIVNLIHNT   135


NP_001864.1        150   RIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   199
NP_001092029.1     150   RIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   199
XP_001097378.2     150   RIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   199
XP_005629450.1      38   RIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   87
NP_776328.2        149   RIHIMPSLNPDGFEKAASQLGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   198
NP_038522.2        150   RIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   199
NP_037260.1        150   RIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   199
XP_420392.3        143   RIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVY   192
NP_999975.1        128   RIHIMPSMNPDGFEKAASQPGEMKDWFVGRSNAQGIDLNRNFPDLDRIVY   177
NP_501935.1        137   SIHILPSMNPDGFELALGTEPAQRQWLTGRSNINGVDLNRDFPDLDSIFY   186
NP_001106417.1     136   RIHIMPSLNPDGFEKAAQQPGDIKDWFVGRSNAQGIDLNRNFPDLDRIVY   185


NP_001864.1        200   VNEKEGGPN-NHLLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLH   248
NP_001092029.1     200   VNEKEGGPN-NHLLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLH   248
XP_001097378.2     200   VNEKEGGPN-NHLLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLH   248
XP_005629450.1      88   VNEKEGGPN-NHLLKNLKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLH   136
NP_776328.2        199   INEKEGGPN-NHLLKNLKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLH   247
NP_038522.2        200   VNEKEGGPN-NHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLH   248
NP_037260.1        200   VNEKEGGPN-NHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLH   248
XP_420392.3        193   VNEKEGGPN-NHLLKNMKKAVDQNPKLAPETKGVIHWIMDIPFVLSANLH   241
NP_999975.1        178   MNEREGGAN-NHLLKNMKKAVDENTKLAPETKAVIHWIMDIPFVLSANLH   226
NP_501935.1        187   ELQKIGVPKFDHLLSLFEDNVDRQ----PETIAVGQWTLSLPFVLSANFH   232
NP_001106417.1     186   LNEREGGTN-NHLLQNLKKSVDENAKLAPETVAVIHWIMDIPFVLSANLH   234


NP_001864.1        249   GGDLVANYPYDETRSGSAHE--YSSSPDDAIFQSLARAYSSFNPAMSDPN   296
NP_001092029.1     249   GGDLVANYPYDETRSGSAHE--YSSSPDDAIFQSLARAYSSFNPAMSDPN   296
XP_001097378.2     249   GGDLVANYPYDETRSGSAHE--YSSSPDDAIFQSLARAYSSFNPAMSNPN   296
XP_005629450.1     137   GGDLVANYPYDETRSGSAHE--YSSCPDDAIFQSLARAYSSFNPPMSDPN   184
NP_776328.2        248   GGDLVANYPYDETRSGSAHE--YSSCPDDDIFQSLARAYSSFNPPMSDPD   295
NP_038522.2        249   GGDLVANYPYDETRSGTAHE--YSSCPDDAIFQSLARAYSSFNPVMSDPN   296
NP_037260.1        249   GGDLVANYPYDETRSGTAHE--YSSCPDDAIFQSLARAYSSFNPVMSDPN   296
XP_420392.3        242   GGDLVANYPYDETRSGSAHE--YSSCPDDAIFQSLARSYSSLNPAMSDPN   289
NP_999975.1        227   GGDVVANYPYDETRSGSTHE--YSASPDDLVFKSLAKAYSIYNPVMSDTN   274
NP_501935.1        233   EGDLVANYPFDAAIDENSQKTAYSASPDDGTFRWLAKSYADNHAHMSKND   282
NP_001106417.1     235   GGDLVANYPYDKTRSGSTHE--YSACPDDGIFQSLARSYSSLNPTMSDPD   282


NP_001864.1        297   RPPCRKNDDDS-SFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSC   345
NP_001092029.1     297   RPPCHKNDDDS-SFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSC   345
XP_001097378.2     297   RPPCRKNDDDS-SFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSC   345
XP_005629450.1     185   RPPCRKNDDDS-SFIDGTTNGAAWYSVPGGMQDFNYLSSNCFEITVELSC   233
NP_776328.2        296   RPPCRKNDDDS-SFVEGTTNGAAWYSVPGGMQDFNYLSSNCFEITVELSC   344
NP_038522.2        297   RPPCRKNDDDS-SFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSC   345
NP_037260.1        297   RPPCRKNDDDS-SFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSC   345
XP_420392.3        290   RPPCRKNDDDS-SFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSC   338
NP_999975.1        275   RPPCRKNDDDS-SFKEGITNGGAWYSVPGGMQDFNYLSSNCFEITLELSC   323
NP_501935.1        283   HAPCDGTSQDAFARQGGITNGAKWYSVAGGMQDFNYLATNAMEITLELSC   332
NP_001106417.1     283   RKPCRKSDDDS-SFIDGTTNGAAWYSVPGGMQDFNYLSSNCFEITVELGC   331


NP_001864.1        346   EKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFVRD-LQGNPIANATIS   394
NP_001092029.1     346   EKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFVRD-LQGNPIANATIS   394
XP_001097378.2     346   EKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFVRD-LQGNPIANATIS   394
XP_005629450.1     234   EKFPPEESLRSYWEDNKNSLVRYLEQIHRGVKGFVRD-LQGNPIANATIS   282
NP_776328.2        345   EKFPPEETLKNYWEDNKNSLISYIQQIHRGVKGFVRD-LQGNPIANATLS   393
NP_038522.2        346   EKFPPEETLKSYWEDNKNSLISYLEQIHRGVKGFVRD-LQGNPIANATIS   394
NP_037260.1        346   EKFPPEETLKSYWEDNKNSLINYLEQIHRGVKGFVRD-LQGNPIANATIS   394
XP_420392.3        339   EKFPPEETLKGYWEDNKNSLINYIEQIHRGVKGFVKD-LQGNPIANATIS   387
NP_999975.1        324   DKFPPEDSLKQYWDQNRNSLVNYIEQVHRGVSGFVRD-LQGNPISNASVS   372
NP_501935.1        333   EKMPEGSQLPRFWEDNQKSIFEYVWKSHSGVKGMVVDAMTGEPIKRAVVW   382
NP_001106417.1     332   DKFPPEEMLKSYWEENKDSLVNYLMQVHRGVTGFVKD-HHGFPIANATIS   380


NP_001864.1        395   VEG------IDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAITKKVAVP   438
NP_001092029.1     395   VEG------IDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAVTKKVAVP   438
XP_001097378.2     395   VEG------IDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAITKKVAVP   438
XP_005629450.1     283   VEG------IDHDVTSAKDGDYWRLLVPGNYKLTASAPGYLATTKKVAVP   326
NP_776328.2        394   VEG------IDHDVTSAKDGDYWRLLVPGNYKLTASAPGYLAIAKKVAVP   437
NP_038522.2        395   VDG------IDHDVTSAKDGDYWRLLAPGNYKLTASAPGYLAITKKVAVP   438
NP_037260.1        395   VDG------IDHDVTSAKDGDYWRLLAPGNYKLTASAPGYLAITKKVAVP   438
XP_420392.3        388   VEG------ISHDITSAKDGDYWRLLVPGNYKLTASAPGYLAITKKVAVP   431
NP_999975.1        373   VEG------IDHDITTAKDGDYWRLLAPGNYKVSASAPGYLTVVKKVAVP   416
NP_501935.1        383   IRNGTETVPVKHPVTTWSEGDFYRVLPAGKYEIIVAAEGYDIAAKNVTVE   432
NP_001106417.1     381   VDG------IDHDVTSAKDGDYWRLLAPGNYKITASAPGYLAVAKKVAVP   424


NP_001864.1        439   Y---SPAAGVDFELE-SFSERKEEEKEELMEWWKMMSETLNF   476
NP_001092029.1     439   Y---SPAAGVDFELE-SFSGRKEEEKEELMEWWKMMSETLNF   476
XP_001097378.2     439   Y---SPAVGVDFELE-SFSERKEEEKEELMEWWKMMSETLNF   476
XP_005629450.1     327   Y---SPAVGVDFELE-SFSERKEEEKEELMEWWKMMSETLNF   364
NP_776328.2        438   Y---SPAVRVDFELE-SFSERKEEEKEELMEWWKMMSETLNF   475
NP_038522.2        439   F---SPAVGVDFELE-SFSERKEEEKEELMEWWKMMSETLNF   476
NP_037260.1        439   F---SPAVGVDFELE-SFYERKEEEKEELMEWWKMMSETLNF   476
XP_420392.3        432   F---SPAVVVDFELE-SLSERKEEEKEELMEWWKMMSETLNF   469
NP_999975.1        417   H---SPSTRLDFELE-SLEERKEEEKEELMDWWKMMSETLNF   454
NP_501935.1        433   NKVRDSALVVNFALSPAADEPSENEQEQIAELVNEIARRR--   472
NP_001106417.1     425   Y---SPAVKIDFDLE-SLSERKEEEKEEMMEWWKMMSQTLNF   462


Protein Acc. Gene Organism
NP_001864.1 CPE H.sapiens
NP_001092029.1 CPE P.troglodytes
XP_001097378.2 CPE M.mulatta
XP_005629450.1 CPE C.lupus
NP_776328.2 CPE B.taurus
NP_038522.2 Cpe M.musculus
NP_037260.1 Cpe R.norvegicus
XP_420392.3 CPE G.gallus
NP_999975.1 cpe D.rerio
NP_501935.1 egl-21 C.elegans
NP_001106417.1 cpe X.tropicalis


Support Center