Display Settings:

Format

Send to:

Choose Destination
HomoloGene:4371. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_057653.3          1   MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG   50
XP_001154426.1       1   MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG   50
XP_001111920.1       1   MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG   50
XP_005636571.1       1   MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG   50
XP_002694634.3       1   MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG   50
NP_035665.2          1   MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG   50
NP_853669.1          1   MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG   50
NP_001257807.1       1   MNIPMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALALPPNG   50
NP_001095140.2       1   ----MRDPVIQGSSMAYHPFLPHRGPEFAMSAMLGHQPPFFPALALPPNG   46
NP_001027524.1       1   MNLPMRDPVISGSAMAYHPFLSHRAPDFAMSAVLGHQPPFFPALALPPNG   50


NP_057653.3         51   AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQ--AHLRPLKTMEPEEE   98
XP_001154426.1      51   AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQ--AHLRPLKTMEPEEE   98
XP_001111920.1      51   AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQ--AHLRPLKTMEPEEE   98
XP_005636571.1      51   AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQ--AHLRPLKTMEPEEE   98
XP_002694634.3      51   AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQ--THLRPLKTMEPEEE   98
NP_035665.2         51   AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQ--AHLRPLKTMEPEED   98
NP_853669.1         51   AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQ--AHLRPLKTMEPEED   98
NP_001257807.1      51   AAALSLPGALAKPIMDQLVGAAETAIPFSSLGHQAAAHLRPLKTLEPEEE   100
NP_001095140.2      47   --SLSLPGALGKPIMEQLMGAAETGLHFSSLGHQ-AAHLRPLKTLEPEEE   93
NP_001027524.1      51   -AALSLPGALAKPIMDQLVGAAETGIPFSSLGHQAAAHLRPLKTLEPEEE   99


NP_057653.3         99   VEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   148
XP_001154426.1      99   VEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   148
XP_001111920.1      99   VEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   148
XP_005636571.1      99   VEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   148
XP_002694634.3      99   VEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   148
NP_035665.2         99   VEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   148
NP_853669.1         99   VEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   148
NP_001257807.1     101   VEDDPKVHLEAKELWEQFHKRGTEMVITKSGRRMFPPFKVRCTGLDKKAK   150
NP_001095140.2      94   VEDDPKVHLEAKELWELFHKRGTEMVITKSGRRMFPPFKVRCTGLDKKAK   143
NP_001027524.1     100   VEDDPKVHLEGKDLWEQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAK   149


NP_057653.3        149   YILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   198
XP_001154426.1     149   YILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   198
XP_001111920.1     149   YILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   198
XP_005636571.1     149   YILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   198
XP_002694634.3     149   YILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   198
NP_035665.2        149   YILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   198
NP_853669.1        149   YILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   198
NP_001257807.1     151   YILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   200
NP_001095140.2     144   YILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   193
NP_001027524.1     150   YILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM   199


NP_057653.3        199   SKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKY   248
XP_001154426.1     199   SKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKY   248
XP_001111920.1     199   SKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKY   248
XP_005636571.1     199   SKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKY   248
XP_002694634.3     199   SKVVTFHKLKLTNNISDKHGFTLAFPSDQATWQGNYSFGTQTILNSMHKY   248
NP_035665.2        199   SKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKY   248
NP_853669.1        199   SKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKY   248
NP_001257807.1     201   SKVVTFHKLKLTNNISDKHGF--------------------TILNSMHKY   230
NP_001095140.2     194   SKVVNFHKLKLTNNISDKHGF--------------------TILNSMHKY   223
NP_001027524.1     200   SKVVTFHKLKLTNNISDKHGF--------------------TILNSMHKY   229


NP_057653.3        249   QPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNP   298
XP_001154426.1     249   QPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNP   298
XP_001111920.1     249   QPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNP   298
XP_005636571.1     249   QPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNP   298
XP_002694634.3     249   QPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNP   298
NP_035665.2        249   QPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNP   298
NP_853669.1        249   QPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNP   298
NP_001257807.1     231   QPRFHIVRANDILKLPYSTFRTYVFPETEFIAVTAYQNDKITQLKIDNNP   280
NP_001095140.2     224   QPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDHNP   273
NP_001027524.1     230   QPRFHIVRANDILKLPYSTFRTYVFPETEFIAVTAYQNDKITQLKIDNNP   279


NP_057653.3        299   FAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNC   348
XP_001154426.1     299   FAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNC   348
XP_001111920.1     299   FAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNC   348
XP_005636571.1     299   FAKGFRDTGNGRREKRKQLTLQSMRVFDDRHKKENGTSDESSSEQAAFNC   348
XP_002694634.3     299   FAKGFRDTGNGRREKRKQLTLQSMRVFDDRHKKENGTSDESSSEQAAFNC   348
NP_035665.2        299   FAKGFRDTGNGRREKRKQLTLQSMRVFEERHKKE--TSDESSSEQAAFNC   346
NP_853669.1        299   FAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKETGTSDESSSEQAAFNC   348
NP_001257807.1     281   FAKGFRDTGNGRREKRKQLTLQSMRVYDERQKKENPTSDESSNEQTAFKC   330
NP_001095140.2     274   FAKGFRDTGNGRREKRKQLALQSMRSYEEQQKKENGTSDDSSGEQASFKC   323
NP_001027524.1     280   FAKGFRDTGNGRREKRKQLALQSMRPYDDHQKKDNGSSDESSSEQTAYKC   329


NP_057653.3        349   FAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTT   398
XP_001154426.1     349   FAQASSPAVSTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTT   398
XP_001111920.1     349   FAQASSPAVSTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTT   398
XP_005636571.1     349   FAQSSSPAVSTVGTSNLKDLCPSEGESDAEADSKEEHGPEACDAAKISTT   398
XP_002694634.3     349   FAQSSSPAVSTVGTSNLKDLCPSEGESDAEADSKEEHGPEACDTAKISTT   398
NP_035665.2        347   FAQASSPAVSIVGTSNLKDLCPSEAESDAEAESKEEHGPEACDAAKISTT   396
NP_853669.1        349   FAQASSPAVSTVGTSNLKDLCPSEAESDAEAESKEEHGPEACDTAKISTT   398
NP_001257807.1     331   FAQSSCPAVPAVGTSSLKDLCPSEGDSD--ADSKDDPLLEASESGKISTT   378
NP_001095140.2     324   FRQASSPAVSTAGHNHLKDFCDSDEDSD--EEDKDANAKEGPDSSKISTT   371
NP_001027524.1     330   FAQTSSPTAPAVGTSSLKGVPPSDGESD--EESRDEGGPDTGESTKISTT   377


NP_057653.3        399   TSEEPC------------RDKGSPAVKAHLFAAE---RPRD-SGRLDKAS   432
XP_001154426.1     399   TSEEPC------------RDKGSPAVKAHLFAAE---RPRD-SGRLDKAS   432
XP_001111920.1     399   TSEEPC------------RDKGSPAVKAHLFAAE---RPRD-SGRLDKAS   432
XP_005636571.1     399   TSEEPS------------RDKGSPALKAHLFAAEPGGRPRD-GGRPDKAS   435
XP_002694634.3     399   TSEDPC------------RDKGSPAVKAHLFAAEPGGRARD-SGRLDKAS   435
NP_035665.2        397   TAEEPG------------RDKGSPATRAQLFPAEP-SRARD-TARLDKAS   432
NP_853669.1        399   TAEEPG------------RDKGSPATRAQLFPAEP-SRARD-TARLDKAS   434
NP_001257807.1     379   TATTPAPASSGAAASDDPRDKGGSPSKSHFFPSDS-ATSRS-RERTEKAP   426
NP_001095140.2     372   TEDS--------------KDQDAGLGKSVFGESDSSS-----GRRSEKTR   402
NP_001027524.1     378   TSED-C------------RELASPPRAPH---SDLGSRSREQSSRTGKSS   411


NP_057653.3        433   PDSRHSPATISSSTR--GLGAEERRSPVREGTAPAK-VEEARALPGKEAF   479
XP_001154426.1     433   PDSRHSPATISSSTR--GLGAEERRSPVREGTAPAK-VEEARALPGKEAF   479
XP_001111920.1     433   PDSRHSPATISSSTR--GLGAEERRSPGREGAAPAK-VEEARALPGKEAF   479
XP_005636571.1     436   PDSRHSPATISSSTR--GLGADERRSPGREGAAPSK-AEEARALPGKEAF   482
XP_002694634.3     436   PDSRHSPATISSSTR--GLGAEERRSPGRDSAATSKAAEEARVLPGKEAF   483
NP_035665.2        433   PDSRHSPATISSSTR--VPGADERRSPGREGPVATK-VDEARAIPAKDAF   479
NP_853669.1        435   PDSRHSPATISSSTR--VPGADEHRSPGREGPVSAK-VDEARALPAKDAF   481
NP_001257807.1     427   PDSRHSPATISSSSRGGGLSGEELKSPLRDGPK----VDENRLL-GKEPF   471
NP_001095140.2     403   ADSRSPITLISSTTR----SGEELKSPVREPAKT---TDDCRTV-SKENY   444
NP_001027524.1     412   PDSRHSPGHISSSSSGRILSIEELKSPARDSHK----AEESQR--SKEAF   455


NP_057653.3        480   APLTVQTDAAAAHLAQGPLPGLGFAPGLAGQQFFN----GHPLFLHPSQF   525
XP_001154426.1     480   APLTVQTDAAAAHLAQGPLPGLGFAPGLAGQQFFN----GHPLFLHPSQF   525
XP_001111920.1     480   APLTVQSDAAAAHLAQGPLPGLGFAPGLAGQQFFN----GHPLFLHPSQF   525
XP_005636571.1     483   APLTVQTDAAAAHLGQGPLPGLGFAPGLAGQQFFN----GHPLFLHPGQF   528
XP_002694634.3     484   APLTVQTDPAAAHLGQGPLPGLGFAPGLAGQQFFN----GHPLFLHPGQF   529
NP_035665.2        480   APLSVQTD-ATAHLAQGPLPGLGFAPGLAGQQFFN----GHPLFLHPGQF   524
NP_853669.1        482   APLSVQTD-ATAHLTQGPLPGLGFAPGLAGQQFFN----GHPLFLHPGQF   526
NP_001257807.1     472   APLTVQTD-STAHLSQGHLQNLGFPPALAGQQFFNPLGSGHPLLLHPGQF   520
NP_001095140.2     445   MPLTVQTD-GAAHLNQNHLHNFGFPPGLAGQQFFNHLGGAHPFLLHPSQF   493
NP_001027524.1     456   PPLTVQTDSSAHLLSQGHLQNLGFPPGLTGQQFFNPLGASHPLLFHPSHF   505


NP_057653.3        526   AMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGASA   575
XP_001154426.1     526   AMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGASA   575
XP_001111920.1     526   AMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGASA   575
XP_005636571.1     529   AMGGAFSGM-AAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGASA   577
XP_002694634.3     530   AMGGAFSSM-AAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGAS-   577
NP_035665.2        525   AMGGAFSSM-AAGMGPLLATVSGASTGVSGLESTAMASAAAAQGLSGASA   573
NP_853669.1        527   AMGGAFSSM-AAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGASA   575
NP_001257807.1     521   AMGGAFSGM-AAGMGPLLATVSGASAGGSGLDSTVMAT-AAAQGLSGAST   568
NP_001095140.2     494   NMGGAFSNM-AAGMGPILAAVS--SGGVGSLDGSSLPS--PSQSLTGAP-   537
NP_001027524.1     506   AMGGAFSSM-AAGMNPLLASVSGASSGVNSIDSTVMAS--SSQGLAGSS-   551


NP_057653.3        576   ATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHR   625
XP_001154426.1     576   ATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHR   625
XP_001111920.1     576   ATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHR   625
XP_005636571.1     578   ATLPFHLQQHVLASQ----VRRGPCLPW-------GRRPSPGSSAYSVHR   616
XP_002694634.3     578   ATLPFHLQQHVLASQ---------------VFISCLCSPSFHALSFACLL   612
NP_035665.2        574   ATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASTAAASSSVHR   623
NP_853669.1        576   ATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHR   625
NP_001257807.1     569   AALPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASS-AASNSVHR   617
NP_001095140.2     538   --MPFHLQQHVLASQGLAMSPFGGLFPYPYTYMAAAAAASS-AASSSVHR   584
NP_001027524.1     552   -ALPFHLQQQVLASQGLAMSPFGGLFSYPYTYMAAAAAASS-----AVHR   595


NP_057653.3        626   HPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTALP-SMAAAAGPLDGKV   674
XP_001154426.1     626   HPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTALP-SMAAAAGPLDGKV   674
XP_001111920.1     626   HPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTALP-SMAAAAGPLDGKV   674
XP_005636571.1     617   HPFLTXPFMRPRLRYSPYSIFMPVPDGSSLLTTALP-AMAAAAGPLDAKA   665
XP_002694634.3     613   EP-------------DPHQVSLPNNNLLLLLGARLI-SLIH---------   639
NP_035665.2        624   HPFLNLNSMRPRLRYSPYSIPVPVPDSSSLLATALP-SMASAAGPLDGKA   672
NP_853669.1        626   HPFLNLNSMRPRLRYSPYSIPVPVPDSSSLLATALP-SMASAAGPLDGKS   674
NP_001257807.1     618   HPFLN--AVRPRLRYSPYPLPVPLPDGSSLLTTAMPGALAATSG--ETKG   663
NP_001095140.2     585   HPFLS--AVRPRLRYSPYSLP-SVPD-STLLTTAMQ---PMASSGLEVKG   627
NP_001027524.1     596   HPFLN--AVRPRLRYSPYSFPMPFAEGSSLLTTALH--------SLDGKA   635


NP_057653.3        675   AALAASPASVAVDSGSELNSRSSTLSSSSMSL-SPKLCAEKEAATSELQS   723
XP_001154426.1     675   AALAASPASVAVDSGSELNSRSSTLSSSSVSL-SPKLCAEKEAATSELQS   723
XP_001111920.1     675   AALAASPASVAVDSGSELNSRSSTLSSSSVSL-SPKLCAEKEAATSELQS   723
XP_005636571.1     666   AALAASPASVAVDSGSELNSRSSTLSSSSVSL-SPKLCPEKEAATSELQS   714
XP_002694634.3     640   ---------------HNLTPTPSKLKKTIFPLMSPKLCPEKEAATSELQN   674
NP_035665.2        673   AALAASPASVAVDSGSELNSRSSTLSSGSVSL-SPKLCSEKEAATSELQS   721
NP_853669.1        675   AVLAASPASVAVDSGSELNSRSSTLSSGSVSL-SPKLCSEKEAATSELQS   723
NP_001257807.1     664   SALASSPGAVPLDSASDLTSRSSTLSSGSVSL-SPKLGADKEAATSELQN   712
NP_001095140.2     628   DGMNTSPASAALD--SEVTSR----SSGSVSL-SPKTCTEKD-SSSELQS   669
NP_001027524.1     636   SLL-SSPAATALD--TELSSRTPTLSSGSVSL-SPKLCPEKE-ASSELQN   680


NP_057653.3        724   IQRLVSGLEAKPDRSRSASP-   743
XP_001154426.1     724   IQRLVSGLEAKPDRSRSASP-   743
XP_001111920.1     724   IQRLVSGLEAKPDRSRSASP-   743
XP_005636571.1     715   IQRLVSGLEAKPDRSRSGSP-   734
XP_002694634.3     675   IQRLVSGLEAKPDRSRSASP-   694
NP_035665.2        722   IQRLVSGLEAKPDRSCSGSP-   741
NP_853669.1        724   IQRLVSGLEAKPDRSCSGSP-   743
NP_001257807.1     713   IQRLVSGLDPKQDRSRSGSP-   732
NP_001095140.2     670   IQRLVSGLEPKPDRARSVSP-   689
NP_001027524.1     681   IQRLVSGLDSKQERSRSGSPD   701


Protein Acc. Gene Organism
NP_057653.3 TBX3 H.sapiens
XP_001154426.1 TBX3 P.troglodytes
XP_001111920.1 TBX3 M.mulatta
XP_005636571.1 TBX3 C.lupus
XP_002694634.3 TBX3 B.taurus
NP_035665.2 Tbx3 M.musculus
NP_853669.1 Tbx3 R.norvegicus
NP_001257807.1 TBX3 G.gallus
NP_001095140.2 tbx3a D.rerio
NP_001027524.1 tbx3 X.tropicalis


Support Center