Display Settings:

Format

Send to:

Choose Destination
HomoloGene:41528. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_775813.2          1   MVGQM--YCYPGSHLARALTRALALALV-----LALLVGPFLSGLAGAIP   43
XP_509397.3              --------------------------------------------------
XP_001104551.2       1   MVGQM--YCSSGSPLARALTRALALALV-----LALLVGLFLSGLAGAIP   43
XP_005636570.1       1   MMWQFIDVNLQGHKNTHAFCATVLLRSFSEVKILEKMWAIL--GLTGATP   48
NP_001039635.1       1   MVAPM--YGSPGGRLARAVTRALALALV-----LALLVGLFLSGLTGAIP   43
NP_076114.2          1   MAAPV--DGSSGGWAARALRRALALTSLTTLALLASLTGLLLSGPAGALP   48
NP_640348.2          1   MAAPM--DRTHGGRAARALRRALA---------LASLAGLLLSGLAGALP   39
XP_003642281.1           --------------------------------------------------
NP_499668.1          1   MNWIF----------------------------IFLAAAVAIGCEARQER   22
XP_002939239.1       1   MGAQ-----------------------------LLLIFMLFSLGAAQQAV   21


NP_775813.2         44   APGGRWARDGQVPPASRSRSVLLDVSAGQL-LMVDGRHPDA------VAW   86
XP_509397.3              --------------------------------------------------
XP_001104551.2      44   APGGRWAHDGPVTPASRSRSVLLHAATGQL-LLVDGRQPDA------VAW   86
XP_005636570.1      49   VSGRRWGPSGPVPPASRSRSVRLDPQTGQF-QLVDGRNPDA------VAW   91
NP_001039635.1      44   TPRGQRGRGMPVPPASRCRSLLLDPETGQL-RLVDGRHPDA------VAW   86
NP_076114.2         49   TLGPGWQRQNPDPPVSRTRSLLLDAASGQL-RLEDGFHPDA------VAW   91
NP_640348.2         40   TLGPGWRRQNPEPPASRTRSLLLDAASGQL-RLEYGFHPDA------VAW   82
XP_003642281.1           --------------------------------------------------
NP_499668.1         23   T------------------YTVCQKPEGDLHYFKEGRKTDEELCAKRLAT   54
XP_002939239.1      22   V------------------SVLFDPATGNITTVEEKRVVGA------VAW   47


NP_775813.2         87   ANLTNAIRETGWAFLELGT-SGQYNDSLQAYAAGVVEAAVSEELIYMHWM   135
XP_509397.3          1   ----------------------------------------MHKLIYMHWM   10
XP_001104551.2      87   ANLTNSIHETGWAFLELGT-SGGYNDSLQAYAAGVVEAAVSEELIYMHWM   135
XP_005636570.1      92   ANLTNAIRDTGWAFLELRT-NGQYNDSLQAYAAGVVEAAVSEELLFLPWM   140
NP_001039635.1      87   ANLTNAIRETGWAFLELHT-NGRFNDSLQAYAAGVVEAAVSEELIYMYWM   135
NP_076114.2         92   ANLTNAIRETGWAYLDLST-NGRYNDSLQAYAAGVVEASVSEELIYMHWM   140
NP_640348.2         83   ANLTNAIRETGWAYLDLGT-NGSYNDSLQAYAAGVVEASVSEELIYMHWM   131
XP_003642281.1           --------------------------------------------------
NP_499668.1         55   AYFHDEVNQTGWAFLEVDVISPKIPHYLQGYAAGFAEGRATRHLIDLHII   104
XP_002939239.1      48   AELKDSILENGWAVLEVQT-NGTFNDSIQAYAAGVAEAAVTQRLIFMHWM   96


NP_775813.2        136   NTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLT   185
XP_509397.3         11   NTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPYSAYWHQVRLT   60
XP_001104551.2     136   NTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSAYWHQVRLT   185
XP_005636570.1     141   NTVVNYCGPFEYQVSYCERLMRFLETNLDWCSRLIKLNKDFAYWHSVRLT   190
NP_001039635.1     136   NTVVNYCGPFEYEVGYCERLKNFLEANLEWMQKEMELNNGSAYWHQVRLT   185
NP_076114.2        141   NTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLT   190
NP_640348.2        132   NTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLT   181
XP_003642281.1           --------------------------------------------------
NP_499668.1        105   NTVNGYCDGAKH---FCDELGEFMVDNLKWMEQEIRENPEDEYWQQVNLT   151
XP_002939239.1      97   NTMMGYCGPYKYQATFCEKLRGYLEANLAWMQDEMEKGQDQEYWHQIHLA   146


NP_775813.2        186   LLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTK-   234
XP_509397.3         61   LLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTK-   109
XP_001104551.2     186   LLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTK-   234
XP_005636570.1     191   LLQLKGLEDSYEGSMTFPTGRFTIKPLGFLLLQLSGDLGDLEPALNKTK-   239
NP_001039635.1     186   LLQLKGLEDSYEGSVAFPTGKFTVKPLGFLLLQISGDLEDLEVALNKTK-   234
NP_076114.2        191   LLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTN-   239
NP_640348.2        182   LLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTN-   230
XP_003642281.1       1   -----------------------------------GDLEDLEAAFNRSA-   14
NP_499668.1        152   VNQLFGLIHGYENQLGAEIDFKQIAVHPIFMIQIAGDLEDLAMKFKKPEN   201
XP_002939239.1     147   LLQLKGLEDSYSGRISFPQGKFHLNPFGFLLFQIGGDLEDLEPALNKSE-   195


NP_775813.2        235   IKPSL-GSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFRE   283
XP_509397.3        110   IKPSL-GSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFRE   158
XP_001104551.2     235   IKPSL-GSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFRE   283
XP_005636570.1     240   TKHIM-GSGSCSALIKLLPGQSDLLIAHNTWSSYQNMLRIIKKYWFQFRE   288
NP_001039635.1     235   TNHAM-GSGSCSALIKLLPGQRDLLVAHNTWHSYQYMLRIMKKYWFQFRE   283
NP_076114.2        240   TKPSL-GSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFRE   288
NP_640348.2        231   TKPSV-GSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFRE   279
XP_003642281.1      15   PRRLL-GSGSCSALLKLLPGRRDLLVAHDTWAPYQSMLRVIKKYTLPFRT   63
NP_499668.1        202   PKKVFSGPGHCSALVKLLPKNEDILFSHVTWSSYGTMLRINKKY--SFKT   249
XP_002939239.1     196   PKRVL-GSGSCSALVKLLPGNKDLFVSHDTWNTYQSMLRIIKKYTFPFQM   244


NP_775813.2        284   GPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPAL   333
XP_509397.3        159   GPRGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPAL   208
XP_001104551.2     284   GPQGDSPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPAL   333
XP_005636570.1     289   DPQENSPLAPGNKLVFSSYPGTLFSCDDFYIMGSGLVTLETTIGNRNPAL   338
NP_001039635.1     284   GPQAESTRAPGNKVIFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPAL   333
NP_076114.2        289   GPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPAL   338
NP_640348.2        280   GPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPAL   329
XP_003642281.1      64   EP-GSTARVPGSIQVFSSYPGTIFSGDDFYILSSGLVALETTIGNSDEAR   112
NP_499668.1        250   GD-------PGQIYSFSSYPASITSTDDFVLTSAKLAILETTIGNYNEKS   292
XP_002939239.1     245   TQNGG-PVVPGWVQTFSSYPGTIFSGDDFYLLSSGLVTLETTIGNSNDAL   293


NP_775813.2        334   WKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDY   383
XP_509397.3        209   WKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDY   258
XP_001104551.2     334   WKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRLNSGTYNNQWMIVDY   383
XP_005636570.1     339   WKYVQPKNCVLEWVRNVVANRLALDGDSWADIFKKFNSGTYNNQWMIVDY   388
NP_001039635.1     334   WKYVQPTGCVLEWMRNVVANRLALDGDSWADIFKRFNSGTYNNQWMIVDY   383
NP_076114.2        339   WKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDY   388
NP_640348.2        330   WKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDY   379
XP_003642281.1     113   WRYLRPQGSVLEWLRNIVANRLARSGAEWASIFQRFNSGTYNNQWMLVDY   162
NP_499668.1        293   LDLITP-NTVLTWIRAEIAHRTASSGLQWAEAFGRHNSGTYNNEWVVVDY   341
XP_002939239.1     294   WKYIKPQDSVMEWLRNIAANRLATGGQEWASIFKKFNSGTYNNQWMIVDY   343


NP_775813.2        384   KAFIPGGP-SPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFE   432
XP_509397.3        259   KAFIPGGP-SPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFE   307
XP_001104551.2     384   KAFIPGGP-SPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFE   432
XP_005636570.1     389   KAFVPGGP-SPGNRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPYFE   437
NP_001039635.1     384   KAFVPGGP-SPGRRVLTVLEQIPGMVVVADRTSELYQKTYWASYNIPSFE   432
NP_076114.2        389   KAFLPNGP-SPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFE   437
NP_640348.2        380   KAFIPNGP-SPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFE   428
XP_003642281.1     163   KAFSPGQA-APQQGLLTVLEQIPGLVMVADKTELLYKQGYWASYNVPYFE   211
NP_499668.1        342   KQFHRGKEVQPETGIIHVVEQMPGHIVHSDKTAHLFRETYWPGYNQPYYK   391
XP_002939239.1     344   NKFNIGQT-DVPNGLLTILEQIPGMVAVADKSDVLYKTGYWASYNVPYFQ   392


NP_775813.2        433   TVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYN   482
XP_509397.3        308   TVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYN   357
XP_001104551.2     433   TVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYN   482
XP_005636570.1     438   SVFNASGLQALVAQYGDWFSYDGSPRARIFRRNQSLVHDLDSMLRLMRYN   487
NP_001039635.1     433   SVFNASGLPALVARYGPWFSYDGSPRAQIFRRNHSLVHDLDSMMRLMRYN   482
NP_076114.2        438   TVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYN   487
NP_640348.2        429   SVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYN   478
XP_003642281.1     212   EIFNASGNLELVQKYGDWFTYDKNPRAQIFRRNETQVHDVDSMVRLMRSN   261
NP_499668.1        392   QIIRFSDTDKMVEKFGDWYSYDKTPRALIFKRDHNTVTDMSSMIALMRSN   441
XP_002939239.1     393   EVFNASGLPALVEKFGDWFTYDKTPRALIFQRDHSKVKDMESMVKLMRYN   442


NP_775813.2        483   DFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGID   532
XP_509397.3        358   DFLHDPLSLCKACDPQPNGENAISARSDLNPANGSYPFQALRQRSHGGID   407
XP_001104551.2     483   DFLHDPLSLCKACDPQPNGENAISARSDLNPANGSYPFQALRQRSHGGID   532
XP_005636570.1     488   DFLHDPLSLCKACSPQANAENAISARSDLNPANGSYPFQALHQRSHGGID   537
NP_001039635.1     483   DFLHDPLSLCKACTPKPNGENAISARSDLNPANGSYPFQALHQRSHGGID   532
NP_076114.2        488   DFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGID   537
NP_640348.2        479   DFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGID   528
XP_003642281.1     262   NYLQDPLSQCQGCNPPHNAENAISARSDLNPANGTYPFAALRQRCHGGTD   311
NP_499668.1        442   NYTKDPLSKCD-CNPPYSAENAIACRSDLNPLNGTYPFKSLGFRDHGAID   490
XP_002939239.1     443   DFLHDPLSRCSSCNPPENGENAISARSDLNTVNGTYPFGAMRQRQHGGTD   492


NP_775813.2        533   VKVTSMSLARILSLLAASGP---TWDQVPPFQWSTSPF-SGLLHMGQPDL   578
XP_509397.3        408   VKVLP-----------------------PP--------------------   414
XP_001104551.2     533   VKVTSTSLLQ---------------DGRCRHLYCCCLP-EG---------   557
XP_005636570.1     538   VKMTSMALAKAFHIIAVSGP---TWDQVPPFQWSSSPF-SGLLHMGQPDV   583
NP_001039635.1     533   VKVTSTALAKALRLLAVSGP---TWDQLPPFQWSTSPF-SGMLHMGQPDL   578
NP_076114.2        538   VKVTSFTLAKYMSMLAASGP---TWDQCPPFQWSKSPF-HSMLHMGQPDL   583
NP_640348.2        529   VKVTSVALAKYMSMLAASGP---TWDQLPPFQWSKSPF-HNMLHMGQPDL   574
XP_003642281.1     312   TKVTSFGMARTFGLVAASGP---TWDDVPPFRWSTSPC-SHLLRMGHPDL   357
NP_499668.1        491   VKVTNSKLINSLQFTAVSGPPGGVTKDVPIFDWKTSPLREKVPHFGQPDR   540
XP_002939239.1     493   MKLTSYEMAKKYEMVVVNGP---TWDQVPPFQWSTSPF-SSLMHMGHPDL   538


NP_775813.2        579   WKFAPVKVSWD--------------------   589
XP_509397.3              -------------------------------
XP_001104551.2           -------------------------------
XP_005636570.1     584   WKFLPIETWWD--------------------   594
NP_001039635.1     579   RKFSPIEVSWD--------------------   589
NP_076114.2        584   WMFSPIRVPWD--------------------   594
NP_640348.2        575   WMFSPVKVPWD--------------------   585
XP_003642281.1     358   WRFPPVKVRWD--------------------   368
NP_499668.1        541   WNFAPVTYKWRKDAHRHYHLYQKLHKELSSL   571
XP_002939239.1     539   WKFSPITIRWH--------------------   549


Protein Acc. Gene Organism
NP_775813.2 PLBD2 H.sapiens
XP_509397.3 PLBD2 P.troglodytes
XP_001104551.2 PLBD2 M.mulatta
XP_005636570.1 PLBD2 C.lupus
NP_001039635.1 PLBD2 B.taurus
NP_076114.2 Plbd2 M.musculus
NP_640348.2 Plbd2 R.norvegicus
XP_003642281.1 PLBD2 G.gallus
NP_499668.1 Y37D8A.2 C.elegans
XP_002939239.1 plbd2 X.tropicalis


Support Center