Display Settings:

Format

Send to:

Choose Destination
HomoloGene:41494. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_073591.2          1   ----------MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLT   40
XP_001156606.1       1   ----------MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLT   40
XP_002804693.1       1   MHHHAWISGTMSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLT   50
XP_005619248.1       1   ----------MSGELPPNINIKEPRWDQSTFVGRANHFFTVTDPRNILLT   40
NP_001015574.1       1   ----------MSGELPPNINIKEPRWDQSTFIGRAKHFFTVTDPRNILLT   40
NP_081600.1          1   ----------MSGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLT   40
NP_001012213.1       1   ----------MSGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLT   40
NP_001264672.1       1   ----------MSADIPLNINIKEPRWDQSTFIGRASHFFTVTDPRNILLS   40
NP_001003537.1       1   ----------MAATISTSINIKEPRWDQGTFVGRAKHFFTVTDPRNILLS   40
NP_649460.3          1   -----------MSPLP-RVNIDEPKYDQNSYLGRAKHFFLLTNPLNVLAS   38
XP_313819.4          1   ----------MAIELP-RVNLDEPRYDQSTYLNRAKHFLIVTNPLNVFAT   39
NP_509949.1          1   -------MSELVKTLVLRPDISKPKWDQSTFEGRAKHFFAITNPLNLFHG   43
NP_001016244.1       1   ----------MSGELALNINIKEPRWDQSTFVGRAKHFFTVTDPRNILLS   40


NP_073591.2         41   NEQLESARKIVHDYRQGI-VPPGLTENELWRAKYIYDSAFHPDTGEKMIL   89
XP_001156606.1      41   NEQLESARKIVHDYRQGI-VPPGLTENELWRAKYIYDSAFHPDTGEKMIL   89
XP_002804693.1      51   NEQLESARKIVRDYRQGI-VPPGLTENELWRAKYVYDSAFHPDTGEKMIL   99
XP_005619248.1      41   NEQLENARKIVHDYRQGI-IPPGLTENELWRAKYIYDSAFHPDTGEKMIL   89
NP_001015574.1      41   NEQLEAARKVVHDYRQGI-IPSGLTENELWRAKYIYDSAFHPDTGEKMIL   89
NP_081600.1         41   NEQLENARKVVHDYRQGI-VPAGLTENELWRAKYAYDSAFHPDTGEKMTL   89
NP_001012213.1      41   NEQLENARKVVHDYRQGI-VPAGLTENELWRAKYAYDSAFHPDTGEKMTL   89
NP_001264672.1      41   DAQLENARKIVHDYRQGI-VAPGLTENELWRAKYIYDSAFHPDTGEKMVL   89
NP_001003537.1      41   NKQLEKAHQIIQDYKKGV-VAADLTEDELWRAKYVFDSAFHPDTGEKMLL   89
NP_649460.3         39   ASKLEEARQIVIKYRAGKDVPECKTIDDVWRAKYLYDSAFHPETGEKQIV   88
XP_313819.4         40   EEQLDRAARIVRDYRAGKPVPDVSSVDELWSAKYLYDSAFHPDTGEKMLL   89
NP_509949.1         44   EKQLDEFKKIVEDYRKGS-VSNDLTLNQLWKAKHVVDSAFHPSTGEKMMM   92
NP_001016244.1      41   NDQLERARQIIHDYRQGT-VEPGLTEDELWRAKYVYDSAFHPDTGEKMIL   89


NP_073591.2         90   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGD   139
XP_001156606.1      90   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGD   139
XP_002804693.1     100   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGD   149
XP_005619248.1      90   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGD   139
NP_001015574.1      90   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGD   139
NP_081600.1         90   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGD   139
NP_001012213.1      90   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGD   139
NP_001264672.1      90   IGRMSAQVPMNMTITGCMMTFYRTTPAVVFWQWINQSFNAIVNYTNRSGD   139
NP_001003537.1      90   IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAIVNYTNRSGD   139
NP_649460.3         89   IGRMAAQMPMNTIITGGMMAFYKSTPAVVFWQWFNQTFNAIVNYTNRSGT   138
XP_313819.4         90   VGRMSAQVPMNMTITGCMMTFYKSTPAVIFWQWFNQSFNAVVNYTNRSGA   139
NP_509949.1         93   VGRMSAQVPMNMAITGGMLTFYKSPMAVIFWQWLNQSFNAVVNYTNRSGD   142
NP_001016244.1      90   IGRMSAQVPMNMTITGCMMTFYRTTPAVVFWQWINQSFNAIVNYTNRSGD   139


NP_073591.2        140   APLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   189
XP_001156606.1     140   APLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   189
XP_002804693.1     150   APLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   199
XP_005619248.1     140   APLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   189
NP_001015574.1     140   APLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   189
NP_081600.1        140   APLTVNELGTAYVSATTGAVATALGLNALTKRVSPLIGRFVPFAAVAAAN   189
NP_001012213.1     140   APLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   189
NP_001264672.1     140   APITVSQLGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   189
NP_001003537.1     140   APITVNQLGTAYVSATTGAVATALGPNALAKHVSPLIGRFVPFAAVAAAN   189
NP_649460.3        139   SPISQQQLVTSYCLATSGALVTALSLNHAVKNMNPLLGRLVPLVAVGAAN   188
XP_313819.4        140   SPISQEQLLTSYCMATGGALVTALSLNRLVRNAPPLVGRLVPLAAVAAAN   189
NP_509949.1        143   GG-SVSQLLVSYCAATGGALTAALGLNSLVKKAPPLVGRLVPFVAVCVAN   191
NP_001016244.1     140   APITVSQLGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAAN   189


NP_073591.2        190   CINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAP   239
XP_001156606.1     190   CINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAP   239
XP_002804693.1     200   CINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAP   249
XP_005619248.1     190   CINIPLMRQRELKIGIPVTDENGNRLGESANAAKQAITQVVISRILMAAP   239
NP_001015574.1     190   CINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAP   239
NP_081600.1        190   CINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAP   239
NP_001012213.1     190   CINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAP   239
NP_001264672.1     190   CINIPLMRQRELKFGIPITDENGNRLGESTKAAQQAITQVVISRILMAAP   239
NP_001003537.1     190   CINIPLMRQRELKHGIPVTDENDNRLGESSKAAQQAITQVVVSRILMASP   239
NP_649460.3        189   CINIPCMRMQELRNGVTLFDEHSNEMGISKKAAVVGISTVILSRIAMAIP   238
XP_313819.4        190   CINIPLMRIQEIKNGVTLLDKDGKELGQSVRAAKEGISAVTFSRILMAMP   239
NP_509949.1        192   SINIPMMRRGELTEGIDILDENGQVIGQSPGVAQSAISQVVVSRIFMAVP   241
NP_001016244.1     190   CINIPLMRQRELKYGIPVTDENGNRIGESPNAAKQAISQVVVSRILMAAP   239


NP_073591.2        240   GMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQ   289
XP_001156606.1     240   GMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQ   289
XP_002804693.1     250   GMAIPPFIMNTLEKKAFLKRFPWMNAPIQVGLVGFCLVFATPLCCALFPQ   299
XP_005619248.1     240   GMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQ   289
NP_001015574.1     240   GMAIPPFIMNTLEKKAFLKRFPWMSAPVQVGIVGFCLVFATPLCCALFPQ   289
NP_081600.1        240   GMAIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQ   289
NP_001012213.1     240   GMAIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQ   289
NP_001264672.1     240   GMAIPPFIMNTLEKRAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQ   289
NP_001003537.1     240   GMAIPPFLMNSLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQ   289
NP_649460.3        239   GMTLTPVLMNVLEKRGFLAKYPRSNAPIQTLFCGFVLIFATPLGCAFFKQ   288
XP_313819.4        240   GMVFTPVLMNTLEKRGFLRRFPWANAPIQTLFCGLCLTFATPLCCALFSQ   289
NP_509949.1        242   SFAFIPVVVNALEKRPYFKANPKMFLPLQTILCGLVLSVSTPVGCALFPQ   291
NP_001016244.1     240   GMAIPPFIMNALEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQ   289


NP_073591.2        290   KSSMSVTSLEAELQAKIQESHPELRRVYFNKGL   322
XP_001156606.1     290   KSSMSVTSLEVELQAKIQESHPELRRVYFNKGL   322
XP_002804693.1     300   KSSMSVTSLEAELQAKIQESHPELRRVYFNKGL   332
XP_005619248.1     290   KSSMSVTSLEAELQAKIQETYPELRRVYFNKGL   322
NP_001015574.1     290   KSSMSVTSLEAELQARIRETYPELRRVYFNKGL   322
NP_081600.1        290   KSSMSVTSLEDELQASIQRTHPEIRRVYFNKGL   322
NP_001012213.1     290   KSSMSVTSLEDELQASIQKSHPELRRVYFNKGL   322
NP_001264672.1     290   KSSMSVTRLEPDLQAKIQENSPELERVYFNKGL   322
NP_001003537.1     290   KSSMAVSRLEPELQEKIRASHPGVETVYFNKGL   322
NP_649460.3        289   RADIKVDSLESEVRDSIRKKRPELETVWFNKGL   321
XP_313819.4        290   KASISVDSIEEELRTKLRKERPELDVVYYNKGL   322
NP_509949.1        292   LTPVSFDQIEPELAQKIKNLPNPPKQLYCNKGL   324
NP_001016244.1     290   KSSMSVTRLEPELQAKIKENSPGLERVYFNKGL   322


Protein Acc. Gene Organism
NP_073591.2 SFXN1 H.sapiens
XP_001156606.1 SFXN1 P.troglodytes
XP_002804693.1 SFXN1 M.mulatta
XP_005619248.1 SFXN1 C.lupus
NP_001015574.1 SFXN1 B.taurus
NP_081600.1 Sfxn1 M.musculus
NP_001012213.1 Sfxn1 R.norvegicus
NP_001264672.1 SFXN1 G.gallus
NP_001003537.1 sfxn1 D.rerio
NP_649460.3 CG11739 D.melanogaster
XP_313819.4 AgaP_AGAP004519 A.gambiae
NP_509949.1 sfxn-1.5 C.elegans
NP_001016244.1 sfxn1 X.tropicalis


Support Center