Display Settings:

Format

Send to:

Choose Destination
HomoloGene:40862. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_037404.2          1   --MQGKKPGGSSGGG----RSGELQGDEAQRNKKKKKKVSCFSNIKIFLV   44
XP_510602.3          1   --MQGKKPGGSSGGGRSGDRSGELQGDEAQRNKKKKKKVSCFSNIKIFLV   48
XP_001100080.2       1   --MQGKKPGGSSGGG----RSGELQGDEAQRNKKKKKKVSCFSNIKIFLV   44
XP_003434421.1       1   --MQGKKPGGSSGGG----RSGELQGDEAQRNKKKKKKVSCFSNIKIFLV   44
NP_001001134.1       1   --MQAKKPGGSSGGG----RSGELQGDEAQRNKKKKKKVSCFSNIKIFLV   44
NP_076397.2          1   --MQGKKPGGSSGGG----RSGELQGDEAQRNKKKKKKVSCFSNIKIFLV   44
NP_803434.1          1   --MQGKKPGGSSGGG----RSGELQGDEAQRNKKKKKKVSCFSNIKIFLV   44
XP_413876.2          1   --MPGKR--GSAGGG-------ELPGAGAARQRRRRRKVSCFSSIQLFLV   39
XP_699020.3          1   MYAEGSTP--------------DTEPDEC------QKKTSCFSNIKIFLI   30
NP_001038653.1       1   --MQVKKQRSSE----------DPQRDDI------KKKPSCFSNIKIFLV   32
XP_002933360.1       1   --MPGKTNRSSSG------RSGDPQGDEAQR-KKKKKKTSCFLNIKIFLV   41


NP_037404.2         45   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   94
XP_510602.3         49   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   98
XP_001100080.2      45   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   94
XP_003434421.1      45   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   94
NP_001001134.1      45   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   94
NP_076397.2         45   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   94
NP_803434.1         45   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   94
XP_413876.2         40   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   89
XP_699020.3         31   SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   80
NP_001038653.1      33   AECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL   82
XP_002933360.1      42   SECALMLAQGTVGAYLVSMLTTLERRFNLQSADVGVIASSFEIGNLALIL   91


NP_037404.2         95   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGA   144
XP_510602.3         99   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGA   148
XP_001100080.2      95   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGA   144
XP_003434421.1      95   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGA   144
NP_001001134.1      95   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGA   144
NP_076397.2         95   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGA   144
NP_803434.1         95   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGA   144
XP_413876.2         90   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYEYESGEIRWGA   139
XP_699020.3         81   FVSYFGARAHRPRLIGCGGIVMALGALLSALPEFLTHQYQYQTGESRPVG   130
NP_001038653.1      83   FVSYFGAKAHRPRLIGCGGIVMALGALLSALPEFLASQYKITD---TWSK   129
XP_002933360.1      92   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEPGEIRWGA   141


NP_037404.2        145   E-GRDVCAANGSGGDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATP   193
XP_510602.3        149   E-GRDVCAANGSGGDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATP   197
XP_001100080.2     145   E-GRDVCAANGSGSDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATP   193
XP_003434421.1     145   E-GRDVCAANGSGGDQGPDPDLICRSRTATNMMYLLLIGAQVLLGIGATP   193
NP_001001134.1     145   E-GRDVCAANGSGGDQGPDPDLICRSRTATNMMYLLLIGAQVLLGIGATP   193
NP_076397.2        145   E-GRDVCATNGSSSDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATP   193
NP_803434.1        145   E-GRDVCATNGSSSDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATP   193
XP_413876.2        140   E-GRDVCAANGSTSDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATP   188
XP_699020.3        131   Q-GQNVC--SNSSRAGLSDPGYICGNRTNTNMMYLLLIGAQMLLGVGATP   177
NP_001038653.1     130   DQGRDVC----SNTSKADEP---CGNRANTNMMYLLLIGAQVLLGIGATP   172
XP_002933360.1     142   E-GRDICSINDTSSGEIPDPDIICSNTATTNMMYLLLIGAQVLLGIGATP   190


NP_037404.2        194   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   243
XP_510602.3        198   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   247
XP_001100080.2     194   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   243
XP_003434421.1     194   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   243
NP_001001134.1     194   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   243
NP_076397.2        194   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   243
NP_803434.1        194   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   243
XP_413876.2        189   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   238
XP_699020.3        178   LQPLGVSYIDDHVRREDSSLYIGILFSTLVFGPACGFILGSLCTKVYVDA   227
NP_001038653.1     173   VQPLGVSYIDDHVRKKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDA   222
XP_002933360.1     191   VQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDA   240


NP_037404.2        244   VFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPH-   292
XP_510602.3        248   VFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPH-   296
XP_001100080.2     244   VFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPH-   292
XP_003434421.1     244   VFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPH-   292
NP_001001134.1     244   VFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSVLMFGFPQSLPPH-   292
NP_076397.2        244   VFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPH-   292
NP_803434.1        244   VFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPH-   292
XP_413876.2        239   VFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFFSSLPMFGFPQSLPPR-   287
XP_699020.3        228   VFIDTTTLDITPDDPRWIGAWWGGFIICGLFLFVSSFFMFGFPQSLNEPG   277
NP_001038653.1     223   LFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQSLPSKE   272
XP_002933360.1     241   FLTDTSKLDITPDDPRWIGAWWAGFLLCGVLLFFSSLLMFGFPQSLSPR-   289


NP_037404.2        293   SEPAMESEQAMLS---EREYERPKPSNGVLRHPLEPDSSASCFQQLRVIP   339
XP_510602.3        297   SDPAMESEQAMLS---EREYERPKPSNGVLRHPLEPDSSASCFQQLRVIP   343
XP_001100080.2     293   SDPAMESEQAMLP---EREYERPKPSNGVLRHPLEPDSSASCFQQLRVIP   339
XP_003434421.1     293   SDPAMESEQAMLP---EREYERPKPSNGVLRHPLEPDSSASCFQQLKVIP   339
NP_001001134.1     293   SDPALESEQAMLP---EREYERPKPSNGVLRHPLEPDSSASCFQQLRVIP   339
NP_076397.2        293   SDPGMESEQAMLP---EREYERPKPSNGVLRHPLEPDSSASCFQQLRVIP   339
NP_803434.1        293   SEPGMESEQAMLP---EREYERPKPSNGVLRHPLEPDSSASCFQQLRVIP   339
XP_413876.2        288   PEHAGESEQAMLP---DRDYERPKPSNGVLRHALDAESSTTCFQQLRVIP   334
XP_699020.3        278   EGPGGESEQAMLPAELVQEYEGVKTSDD-----LEISTGLTCCQHLQVIP   322
NP_001038653.1     273   MEGVPESEQAMLPASLSQDFEKSKPSNGVVQNYQPNSNSLSCCQQLRVIP   322
XP_002933360.1     290   IDRSEESEQTMLP---DTEYERPKPSNGVLRHYSETEDGTSCFQQLRVIP   336


NP_037404.2        340   KVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   389
XP_510602.3        344   KVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   393
XP_001100080.2     340   KVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   389
XP_003434421.1     340   KVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   389
NP_001001134.1     340   KVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   389
NP_076397.2        340   KVTKHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   389
NP_803434.1        340   KVTKHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   389
XP_413876.2        335   KVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   384
XP_699020.3        323   KVTKHLLSNPVFTCVILAACMEIAVVAGFAAFLGKYLEQQFNLSTSSANQ   372
NP_001038653.1     323   KVTKHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   372
XP_002933360.1     337   KVTKHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ   386


NP_037404.2        390   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   439
XP_510602.3        394   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   443
XP_001100080.2     390   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   439
XP_003434421.1     390   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   439
NP_001001134.1     390   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   439
NP_076397.2        390   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   439
NP_803434.1        390   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   439
XP_413876.2        385   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   434
XP_699020.3        373   LLGMTAIPCACLGIFLGGLLVKKLDLSALGAIRLAMIVNIISTACYVSFL   422
NP_001038653.1     373   LLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFL   422
XP_002933360.1     387   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFL   436


NP_037404.2        440   FLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGAD   489
XP_510602.3        444   FLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGAD   493
XP_001100080.2     440   FLGCDTGPVAGVTVPYGNNTAPGSALDPYSPCNNNCECQTDSFTPVCGAD   489
XP_003434421.1     440   FLGCDTGPVAGVTVPYGNTSAPGSALDPYSPCNKNCECQTDSFTPVCGAD   489
NP_001001134.1     440   FLGCDTGPVAGVTVPYGNSSTPGSALDPYSSCNKNCECQTDSFTPVCGAD   489
NP_076397.2        440   FLGCDTGPVAGVTVRYGNNSARGSALDPYSPCNNNCECQTDSFTPVCGAD   489
NP_803434.1        440   FLGCDTVPVAGVTVRYGNNSARGSPLDPYSPCNNNCECQTDSFTPVCGAD   489
XP_413876.2        435   FLGCDTGPVAGVTVPYGNNSTPTSSLDPYSPCNNNCECQTDSFTPVCGAD   484
XP_699020.3        423   FLGCDTGPVAGVTVAYGNESL-GSWERTEAACLSGCNCYKSSLSPVCGSN   471
NP_001038653.1     423   FLGCDTGPVAGVTVAYGNETLQ-VGQTPEAPCMSHCNCYTSSVSPVCGSN   471
XP_002933360.1     437   FLGCDTGPVAGVTVPYGNISVPGASVERYASCNTDCECQTDSFTPVCGAD   486


NP_037404.2        490   GITYLSACFAGCN-----------STNLTGCACLTTVPAENATVVPGKCP   528
XP_510602.3        494   GITYLSACFAGCN-----------STNLTGCACLTTVPAENATVVPGKCP   532
XP_001100080.2     490   GITYLSACFAGCN-----------STNLTGCACLTTVPAENATVVPGKCP   528
XP_003434421.1     490   GITYLSACFAGCN-----------STNLTGCACLTTVPPENTTVVPGKCP   528
NP_001001134.1     490   GITYLSACFAGCN-----------STNLTGCACLMTIPPENATVIPGKCP   528
NP_076397.2        490   GITYLSACFAGCN-----------STNLTGCACLTTVPPENASVVPGKCP   528
NP_803434.1        490   GITYLSACFAGCN-----------STNLTGCACLTTVPPENATVVPGKCP   528
XP_413876.2        485   GVTYLSACFAGCS-----------STNLSGCSCLSSVPAENATVVPGKCP   523
XP_699020.3        472   GVTYLSACLAGCT-----------RTNLTGCKCIAHS-EGLGTATPGKCP   509
NP_001038653.1     472   GVTYLSSCFAGCTRAISTGLPAPLSQNLSGCACISGY-NDFATAVPGKCP   520
XP_002933360.1     487   GITYLSACFAGCT-----------KMNLAGCSCLSSVPVENNTVVPGKCP   525


NP_037404.2        529   SPGCQEAFLTFLCVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLF   578
XP_510602.3        533   SPGCQEAFLTFLCVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLF   582
XP_001100080.2     529   SPGCQEAFLTFLCVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLF   578
XP_003434421.1     529   SPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIRTVSPELKSYALGVLF   578
NP_001001134.1     529   SPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIRTVSPELKSYALGVLF   578
NP_076397.2        529   SPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLF   578
NP_803434.1        529   SPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLF   578
XP_413876.2        524   SPGCEEAFLTFLCVMCVCSMIGAMAQTPSVIILIRTVSPELKSYALGVLF   573
XP_699020.3        510   SPGCQQAFLTFLAVVCACSMIGAMAQTPSVIILIRTVSPELKSYALGVLF   559
NP_001038653.1     521   RPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIRTVSPELKSYALGVLF   570
XP_002933360.1     526   SPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIRAVSPELKSYALGVLF   575


NP_037404.2        579   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVS   628
XP_510602.3        583   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVS   632
XP_001100080.2     579   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVS   628
XP_003434421.1     579   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVAYRYLYVS   628
NP_001001134.1     579   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACALYDNVAYRYLYVS   628
NP_076397.2        579   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVS   628
NP_803434.1        579   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVS   628
XP_413876.2        574   LLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACALYDNVVYRYLYVS   623
XP_699020.3        560   LLLRLLGFIPPPLIFGIGIDSTCLLWSSMCGIKGACMLYDNVTYRYLYVS   609
NP_001038653.1     571   LLLRLLGFIPPPLIFGAGIDSTCLFWSAECGVKGACLLYDNVTYRHLYIS   620
XP_002933360.1     576   LLLRLIGFIPPPLIFGAGIDSTCLFWSTFCGTQGACALYDNVAYRYLYVS   625


NP_037404.2        629   IAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNL   678
XP_510602.3        633   IAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSTEYQDIETEKTC   682
XP_001100080.2     629   IAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSTEYQDIETEKTC   678
XP_003434421.1     629   IAIVLKSSAFVLYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNL   678
NP_001001134.1     629   IAIALKSFAFLLYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNL   678
NP_076397.2        629   IAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNL   678
NP_803434.1        629   IAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFLASTLTLDNL   678
XP_413876.2        624   IAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNL   673
XP_699020.3        610   IAIVLKSSAFILYAVTWQCLRHNYCKYIKNSEDYLTPSQLFASNLTLDNL   659
NP_001038653.1     621   MAIVLKIMAFLLYTTTWHCLRRNYKKYIKNIEGYLTPTEVFSSSMNLDSL   670
XP_002933360.1     626   IAITLKSLAFILYTTTWQCLRKNYKRYIKNHEGGLSASEFFASTLTLDNL   675


NP_037404.2        679   GRDPVPANQTHRTKFIYNLEDHEWCENMESVL   710
XP_510602.3        683   PESHSPSEDS----FVRS--------------   696
XP_001100080.2     679   PESHSPSEDS----FVRS--------------   692
XP_003434421.1     679   GRDPVPASQTHRTKFIYNLEDHEWCENMESVL   710
NP_001001134.1     679   GRDPVPANQTHRTKFIYNLEDHEWCENMESVL   710
NP_076397.2        679   GRDPVPAHQTHRTKFIYNLEDHEWCENMESVL   710
NP_803434.1        679   GRDPVPAHQTHRTKFIYNLEDHEWCENMESVL   710
XP_413876.2        674   GRDSVPQNQPHRTKFIYNLEDHEWCENMESVL   705
XP_699020.3        660   GKD-IAQNPSNRTKFIYNLDDHAWSENMESAI   690
NP_001038653.1     671   GKDS-SQSQVNRTKFIYNLEDHEWCENMESVL   701
XP_002933360.1     676   GKDSVSQNKTHRTKFIYNLEDHEWCENMESVL   707


Protein Acc. Gene Organism
NP_037404.2 SLCO3A1 H.sapiens
XP_510602.3 SLCO3A1 P.troglodytes
XP_001100080.2 SLCO3A1 M.mulatta
XP_003434421.1 SLCO3A1 C.lupus
NP_001001134.1 SLCO3A1 B.taurus
NP_076397.2 Slco3a1 M.musculus
NP_803434.1 Slco3a1 R.norvegicus
XP_413876.2 SLCO3A1 G.gallus
XP_699020.3 LOC570448 D.rerio
NP_001038653.1 slco3a1 D.rerio
XP_002933360.1 slco3a1 X.tropicalis


Support Center