Display Settings:

Format

Send to:

Choose Destination
HomoloGene:38552. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_003313578.1       1   --------------------------------MLMEGGRAAAARNVSSIQ   18
XP_002798531.1       1   --------------------------------MLMEGGRAAAARNVSSIQ   18
XP_866550.2          1   --------------------------------MWMEGGRAAAARNVSSIQ   18
NP_001039802.1           --------------------------------------------------
NP_997105.1              --------------------------------------------------
XP_006237647.1       1   ---------------------------------------MQKQEKSFGIQ   11
XP_004938024.1           --------------------------------------------------
NP_001018575.1           --------------------------------------------------
NP_001259688.1       1   MEYLYNASMHCEDEERVNFYNMDKFFVPHVQSIELEQQQQQSQQSNAGMN   50


XP_003313578.1      19   MLSVQPDTKPKG--------------------------------------   30
XP_002798531.1      19   MLSVQPDTKPKG--------------------------------------   30
XP_866550.2         19   MLSVQPDTKPKG--------------------------------------   30
NP_001039802.1       1   MLSVQPDTKPKG--------------------------------------   12
NP_997105.1          1   MLSVQPDTKPKG--------------------------------------   12
XP_006237647.1      12   MLSVQPDTKPKG--------------------------------------   23
XP_004938024.1       1   MLSVQPDTKPKG--------------------------------------   12
NP_001018575.1       1   MLSVQPDTKPKG--------------------------------------   12
NP_001259688.1      51   SGGQNNGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNN   100


XP_003313578.1      31   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   75
XP_002798531.1      31   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   75
XP_866550.2         31   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   75
NP_001039802.1      13   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   57
NP_997105.1         13   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   57
XP_006237647.1      24   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   68
XP_004938024.1      13   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   57
NP_001018575.1      13   -----CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTK   57
NP_001259688.1     101   NGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTK   150


XP_003313578.1      76   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQL   125
XP_002798531.1      76   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQL   125
XP_866550.2         76   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQL   125
NP_001039802.1      58   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQL   107
NP_997105.1         58   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQL   107
XP_006237647.1      69   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQL   118
XP_004938024.1      58   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQL   107
NP_001018575.1      58   ANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQL   107
NP_001259688.1     151   GNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQ   200


XP_003313578.1     126   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   151
XP_002798531.1     126   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   151
XP_866550.2        126   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   151
NP_001039802.1     108   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   133
NP_997105.1        108   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   133
XP_006237647.1     119   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   144
XP_004938024.1     108   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   133
NP_001018575.1     108   CNQRFCVGDKFFLKNNMILCQTDYEE------------------------   133
NP_001259688.1     201   CNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGS   250


XP_003313578.1     152   ------------GLMKEG-------------------------YAPQVR-   163
XP_002798531.1     152   ------------GLMKEG-------------------------YAPQVR-   163
XP_866550.2        152   ------------GLMKEG-------------------------YAPQVR-   163
NP_001039802.1     134   ------------GLMKEG-------------------------YAPQVR-   145
NP_997105.1        134   ------------GLMKEG-------------------------YAPQVR-   145
XP_006237647.1     145   ------------GLMKEG-------------------------YAPQVR-   156
XP_004938024.1     134   ------------GLMKEG-------------------------YAPQVR-   145
NP_001018575.1     134   ------------GLMKEG-------------------------YAPQVR-   145
NP_001259688.1     251   PTGAAGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGDHNNNNNGPQTPT   300


XP_003313578.1           ---------------------------
XP_002798531.1           ---------------------------
XP_866550.2              ---------------------------
NP_001039802.1           ---------------------------
NP_997105.1              ---------------------------
XP_006237647.1           ---------------------------
XP_004938024.1           ---------------------------
NP_001018575.1           ---------------------------
NP_001259688.1     301   GGGSPFAAAAAAAAAAAHMKNQLGASS   327


Protein Acc. Gene Organism
XP_003313578.1 LMO3 P.troglodytes
XP_002798531.1 LMO3 M.mulatta
XP_866550.2 LMO3 C.lupus
NP_001039802.1 LMO3 B.taurus
NP_997105.1 Lmo3 M.musculus
XP_006237647.1 Lmo3 R.norvegicus
XP_004938024.1 LMO3 G.gallus
NP_001018575.1 lmo3 D.rerio
NP_001259688.1 Bx D.melanogaster


Support Center