Display Settings:

Format

Send to:

Choose Destination
HomoloGene:38235. Gene conserved in Opisthokonta Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_006834.2          1   ------MMSGEPLH--VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKI   42
XP_509398.2          1   ------MMSGEPLH--VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKI   42
XP_001111661.1       1   ------MMSGEPLH--VRTPIRDSMALSKVAGTSVYLKMDSAQPSGSFKI   42
NP_001069130.1       1   ------MMSGRPLH--METPVRDSMTLSKVAGTTAYLKLDSAQPSGSFKI   42
NP_663540.1          1   ------MAAQESLH--VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKI   42
NP_446414.3          1   ------MAAQESLH--VKTPLRDSMALSKVAGTSVFLKMDSSQPSGSFKI   42
XP_003709693.1       1   MGSYSV----EPVKPWVETPCLYSPQVSRAAGCNIYLKLDNLQPSGSFKS   46
XP_961108.1          1   MGSVSFPASSEPPKPWVETPLIYSAQLSNAAGCNIYLKLENVQPSGSFKS   50
XP_002939238.2       1   ------MPENKCLH--LNTPLRDSVPLSKLAGITVYLKLDNAQPTGSFKI   42


NP_006834.2         43   RGIGHFCKRWAK----------------------QGCAHFVCSSAGNAGM   70
XP_509398.2         43   RGIGHFCKRWAK----------------------QGCAHFVCSSAGNAGM   70
XP_001111661.1      43   RGIGHFCKRWAK----------------------QGCAHFVCSSAGNAGM   70
NP_001069130.1      43   RGIGHLCKMWAE----------------------RGCEHFVCSSAGNAGM   70
NP_663540.1         43   RGIGHLCKMKAK----------------------QGCRHFVCSSAGNAGM   70
NP_446414.3         43   RGIGHLCKMKAK----------------------QGCKHFVCSSAGNAGM   70
XP_003709693.1      47   RGIGNMMQRAIALTP-------------------RDDVHFYCPSGGNAGL   77
XP_961108.1         51   RGIGNMMLRSTLPSPPSSPSSSSTTSFQEPLTTNQRKIHFFCSSAGNAGL   100
XP_002939238.2      43   RGIGNLCKTWAE----------------------RGCKHFVCSSGGNAGL   70


NP_006834.2         71   AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA   120
XP_509398.2         71   AAAYAARQLGVPATIVVPSTTPAVTIERLKNEGATVKVVGELLDEAFELA   120
XP_001111661.1      71   AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA   120
NP_001069130.1      71   AAAYAARKLGIPSTIVVPSTTPALTIQRLKNEGATVKVVGETLDEAIRVA   120
NP_663540.1         71   ATAYAARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVA   120
NP_446414.3         71   ATAYAARRLGLPATIVVPSTTPALTIERLKNEGATVEVVGEMLDEAIQLA   120
XP_003709693.1      78   ACATSAASLGKPATIVVPIKTPAHMVEKLEALGAEVLRRGGSIAEADAYL   127
XP_961108.1        101   ACATTAHTLACPATIVVPTSAQEPVLRRLRGLGATVVIHGSSWFEADTHL   150
XP_002939238.2      71   AAAYSARMLSIPATIIVPITTPTFTIQRMKDEGASVFVVGEILDEAIEHA   120


NP_006834.2        121   KALA---------------------KNNPGWVYIPPFDDPLIWEGHASIV   149
XP_509398.2        121   KALA---------------------KNNPGWVYIPPFDDPLIWEGHASIV   149
XP_001111661.1     121   KALA---------------------KNNPGWVYIPPFDDPLIWEGHASIV   149
NP_001069130.1     121   KDLE---------------------KNNSGWVYVPPFDDPLIWEGHSSIV   149
NP_663540.1        121   KALE---------------------KNNPGWVYISPFDDPLIWEGHTSLV   149
NP_446414.3        121   KALE---------------------KNNPGWVYISPFDDPLIWEGHTSLV   149
XP_003709693.1     128   KSQLL--------------------INDPNGVYVSPFDHPDIWEGASSIV   157
XP_961108.1        151   REVVMPASALEDLQESSSGGEEGEKTKQTKQVYVPPFDHEDIWSGAATLM   200
XP_002939238.2     121   KELV---------------------RNNPGWVYIPPFDDPLIWEGHTSLV   149


NP_006834.2        150   KELKETLWEKPGA------IALSVGGGGLLCGVVQGL-------------   180
XP_509398.2        150   KELKETLWEKPGA------IALSVGGGGLLCGVVQGL-------------   180
XP_001111661.1     150   KELKEALWEKPGA------IALSVGGGGLLCGVVQGL-------------   180
NP_001069130.1     150   KELKETMTEKPGA------IVLAVGGGGLLCGVVQGL-------------   180
NP_663540.1        150   KELKETLSAKPGA------IVLSVGGGGLLCGVVQGL-------------   180
NP_446414.3        150   KELKETLSAKPGA------IVLSVGGGGLLCGVVQGL-------------   180
XP_003709693.1     158   DEITTQMRLQPGGPKEADGIVCNVGGGGLLIGIMDGL-------------   194
XP_961108.1        201   DEVAEQMRVVHRA--YVDAVVCNVGGGGLLNGIMEGVWGPSRNPGTGKEG   248
XP_002939238.2     150   KEIKASLPSKPGA------IALSVGGGGMLCGVVQGL-------------   180


NP_006834.2        181   ---QEVGWG----DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKAL   223
XP_509398.2        181   ---QEVGWG----DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKAL   223
XP_001111661.1     181   ---QEVGWG----DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKAL   223
NP_001069130.1     181   ---AEVGWR----DVPVITMETIGAESFHASTKAGKLVTLPCITSVAKAL   223
NP_663540.1        181   ---REVGWE----DVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKAL   223
NP_446414.3        181   ---REVGWE----DVPIIAMETFGAHSFHAAVKEGKLVTLPKITSVAKAL   223
XP_003709693.1     195   ---DRIYCGRPQNQPRVLAVETRGAESLDASIRAGELVTLPNITSICSSL   241
XP_961108.1        249   GLGKEVGGGK---EPRVLAIETVGADSFNQSVKAGELVKMKQITSIASSL   295
XP_002939238.2     181   ---REEGWD----DVPIIAMETRGAHSLNAALQAGKLVTLPEITSVAKTL   223


NP_006834.2        224   GVKTVGAQAL---KLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPAC   270
XP_509398.2        224   GVKTVGAQAL---KLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPAC   270
XP_001111661.1     224   GVKTVGAQAL---KLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPAC   270
NP_001069130.1     224   GVTTVAAQAM---KVYREHPIFSEVVSDQEAVAALEKFVDDEKILVEPAC   270
NP_663540.1        224   GVNTVGAQTL---KLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPAC   270
NP_446414.3        224   GVNTVGAQTL---KLFYEHPIFSEVISDQEAVTAIEKFVDDEKILVEPAC   270
XP_003709693.1     242   GVARVAPRAYEWTKAAAGQ-LATTVVDDADAVMGSVKFLDDARLLVEVAC   290
XP_961108.1        296   GAVQVSKKTWEWSQMVGGENLVSATVTDAEAAMASVRFADEHRMLVEVSC   345
XP_002939238.2     224   GAKTVGAQTL---KVAQEHPVFSEVISDQEAVMAIEKFADDEKMLVEPAC   270


NP_006834.2        271   GAALAAVYSHVIQKLQLEGNLRTPLP--SLVVIVCGGSNISLAQLRALKE   318
XP_509398.2        271   GAALAAVYSHVIQKLQLEGNLRTPLP--SLVVIVCGGSNISLAELRALKE   318
XP_001111661.1     271   GAALAAVYSHVIQKLQREGNLQAPLP--SLVVIVCGGSNISLAQLRALKE   318
NP_001069130.1     271   GAALAAVYSNVIQKLQGEGKLRTPLS--SLVVIVCGGSNISLAQLVALKK   318
NP_663540.1        271   GAALAAVYSRVVCRLQDEGRLQTPLA--SLVVIVCGGSNISLAQLQALKV   318
NP_446414.3        271   GAALAAVYSGVVCRLQAEGRLQTPLA--SLVVIVCGGSNISLAQLQALKA   318
XP_003709693.1     291   GATISVVYNGQLRQKLGKGLSDAEWAEKNIVLVVCGGSHTTLEALLRYRE   340
XP_961108.1        346   GATLATAYNGDLRRYLGKGLSDEEWRNVNVVMVVCGGSHVSVDVLKAYRE   395
XP_002939238.2     271   GAALAAVYSNVAERLKKEGKLSPDLS--SLVIIVCGGNNITLAQLFQLKK   318


NP_006834.2        319   QLGMTNRLPK   328
XP_509398.2        319   QLGMTNGLPK   328
XP_001111661.1     319   QLGMTNGLPK   328
NP_001069130.1     319   QLGM-DGLSQ   327
NP_663540.1        319   QLGL-NGLPE   327
NP_446414.3        319   QLGL-NELLK   327
XP_003709693.1     341   EFGV------   344
XP_961108.1        396   KYGPEIAWA-   404
XP_002939238.2     319   QLGMLSKSSA   328


Protein Acc. Gene Organism
NP_006834.2 SDS H.sapiens
XP_509398.2 SDS P.troglodytes
XP_001111661.1 SDS M.mulatta
NP_001069130.1 SDS B.taurus
NP_663540.1 Sds M.musculus
NP_446414.3 Sds R.norvegicus
XP_003709693.1 MGG_06950 M.oryzae
XP_961108.1 NCU03761 N.crassa
XP_002939238.2 sds X.tropicalis


Support Center