Display Settings:

Format

Send to:

Choose Destination
HomoloGene:38230. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_006802.1          1   MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLST   50
XP_001152172.1       1   MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLST   50
XP_001110325.1       1   MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTLTRLIYAFILLLST   50
XP_534427.3          1   MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILFLGA   50
NP_001076881.1       1   MGAVLGVFSLASWVPCLCGGASCLLCSCCPNSKNSTLTRLIYAFILFLGT   50
NP_036162.3          1   MGAVLGVFSLASWVPCLCSGASCLLCSCCPISKNSTVTRLIYAFILFLGT   50
NP_001008313.1       1   MGAVLGVFSLASWVPCLCSGASCLLCSCCPMSKNSTVTRLIYASILILGT   50
NP_001006291.1       1   MGAVLGVCSLASWIPCLCGGASCLLCRCCPNSKNSTVTRLIYALLLLLST   50
XP_003199457.1       1   MSAVLR--SLTRWVSCLCSCASCLTCRCCPHIRNSIVTRIMYAFILLLGT   48
NP_001185008.1       1   ------MFAASCLASC-CAACACDACRTVVSGISRRSARIAYCGLFALSL   43
NP_001048364.1       1   ------MWAASCLASC-CAACACEACRTAVGSIGRRSARIAYCGLFALSL   43
NP_001016331.1       1   MGGVLGLCSVASWIPCLCSSATCLLCRCCPNTGNSTVTRIVYAFLMLLGA   50


NP_006802.1         51   VVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAVYR   100
XP_001152172.1      51   VVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAVYR   100
XP_001110325.1      51   VVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAVYR   100
XP_534427.3         51   ALSCIMLTEGMETQLKKIPGFCEGGFKINMADRKVDKDCDVLVGYKAVYR   100
NP_001076881.1      51   IVCCIMFHEGMETQLKKIPGFCDEGLSTRITDI-MDKECDVLVRYKAVYR   99
NP_036162.3         51   IVSCIMMTEGIQTQLKKIPGFCEGGFQIKMVDTKAEKDCDVLVGFKAVYR   100
NP_001008313.1      51   IVSCIMMTEGIQTQLKKIPGFCEGEFQIKIVDTKAEKDCDVLVGFKAVYR   100
NP_001006291.1      51   AVACIMLAPGMEEQLKKVPGFCDEGLHTRIPHLNGFVSCDVFVGYRAVYR   100
XP_003199457.1      49   IIACVMLSPGVEQQLKRIPGFCTGGARSGYPGIEANVQCEMFVGYKAVYR   98
NP_001185008.1      44   IVSWI-LREVAAPLMEKLP-------WINHFHKTPDRE---WFETDAVLR   82
NP_001048364.1      44   FASWA-LREVAAPLLQSIP-------WINHFHKTPDRE---WFETDAVLR   82
NP_001016331.1      51   ILSCIMLSPGISDQLKKVPGFCEDGFGTQLPHVDGYVNCNVLVGYKAVYR   100


NP_006802.1        101   ISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFY   150
XP_001152172.1     101   ISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFY   150
XP_001110325.1     101   ISFAMAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFY   150
XP_534427.3        101   INFALAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFY   150
NP_001076881.1     100   ISFALAVFFFAFSLLMLNVKTSKDPRAAIHNGFWFFKIAAIVGVMVGSFY   149
NP_036162.3        101   INFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFY   150
NP_001008313.1     101   INFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMVGSFY   150
NP_001006291.1     101   ISFAMAVFFFVFSLLMIAVRTSNDPRAAVHNGFWFFKIAAIVGIMVGAFY   150
XP_003199457.1      99   VCCGMSLFFLTFSLFMIRVKNSRDPRAAVHNGFWCFKIAVMISVTAGAFY   148
NP_001185008.1      83   VSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVIFMFF   132
NP_001048364.1      83   VSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFF   132
NP_001016331.1     101   VSFAMTLFFLAMSIFMLGVKTSKDPRAAIHNGFWFFKVLALAGIMVGAFY   150


NP_006802.1        151   IPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPR   200
XP_001152172.1     151   IPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPR   200
XP_001110325.1     151   IPGGYFSSVWFVAGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPR   200
XP_534427.3        151   IPGGHFTTAWFIVGMVGAFLFILIQLVLLVDFAHSWNESWVSRMEEGNPR   200
NP_001076881.1     150   IPGGHFNTAWFVIGMVGAAFFILIQLVLLVDFAHSWNESWVNRMEEGNPK   199
NP_036162.3        151   IPGGSFTEVWFVAGMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPR   200
NP_001008313.1     151   IPGGHFTKVWFSAGMLGATFFIFIQLVLLVDLAHSWNELWVNRMEEGNPR   200
NP_001006291.1     151   IPEGPFTRAWFAIGVCGAFCFILIQLVFLVDFAHSWNESWVGRMEEGNSK   200
XP_003199457.1     149   IPDEPFTRMWFIVGSGGAFCFILIQLVLLIDFAHSWNESWVDKMEKENEK   198
NP_001185008.1     133   LPNE-IISFYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGY----DEQ   177
NP_001048364.1     133   VPNG-VVSFYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAK----DEQ   177
NP_001016331.1     151   IPEGHFTSAWFWIGVCGACCFIIFQLILLVDFAHSLNESWVNRMEDGNSK   200


NP_006802.1        201   LWYAALLSFTSAFYILSIICVGLLYTYYTKP-DGCTENKFFISINLILCV   249
XP_001152172.1     201   LWYAALLSFTSAFYILSIICVGLLYTYYTKP-DGCTENKFFISINLILCV   249
XP_001110325.1     201   LWYAALLSFTSAFYILSIICVGLLYTYYTKP-DGCTENKFFISINLILCV   249
XP_534427.3        201   CWYAALLSVTSICYILSVVFVGLLYTYYTKP-DGCTENKFFISINLILCF   249
NP_001076881.1     200   CWYAALLSVTSLFYILSIIFAGLLYTYYTKP-DGCTENKFFISFNLILCV   248
NP_036162.3        201   LWYAALLSFTSLFYILSIVFAALLYVFYTKP-DDCTENKVFISLNLIFCV   249
NP_001008313.1     201   LWYAALLSFTSLFYILSIVFAALLYIFYTKP-DGCTENKVFISLNLIFCV   249
NP_001006291.1     201   CWYAALLSCTSLFYGLSVVFVVLFYVFYTTP-EDCTENKFFISFNMILCF   249
XP_003199457.1     199   RWYIALVLVTGLNYILSFSAALLCFSIYTQP-EGCVLNKFFICFNMLLCV   247
NP_001185008.1     178   FWYAALLVVSLVCYLATFVFSGFLFHWFTPSGHDCGLNTFFIIMTLIFVF   227
NP_001048364.1     178   FWYMALLVVSVVCYIVTFSFSGLLFHWFTPSGHDCGINLFFIVFTLILVF   227
NP_001016331.1     201   CWYAVLLSFTILCYSLSIIGVVLLYVYYTKS-DGCTENKFFISFNMILCV   249


NP_006802.1        250   VASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEP-DRSCNPN   298
XP_001152172.1     250   VASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEP-DRSCNPN   298
XP_001110325.1     250   VASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEP-DRSCNPS   298
XP_534427.3        250   VVSIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEP-DRSCNPG   298
NP_001076881.1     249   VISVLSIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEP-DRSCNPG   297
NP_036162.3        250   AVSIVSILPKVQEHQPRSGLLQSSIITLYTLYLTWSAMTNEP-ERSCNPS   298
NP_001008313.1     250   AVSIVSILPKVQEHQPRSGLLQSSIITLYTLYLTWSAMTNEP-DRSCNPS   298
NP_001006291.1     250   AVSVVSIIPKVQEYHPRSGLLQSSIITLYTMYLTWSAMSNEP-ERNCNPS   298
XP_003199457.1     248   TASALSVLPTIQEYQPRSGLLQSSIMTLYTMYLTWSAMTNEP-DRTCNPS   296
NP_001185008.1     228   VFAIVVLHPTVG-----GSILPASVISLYCMYLCYSGLASEPRDYECN-G   271
NP_001048364.1     228   VFAIVALHPKIN-----GSLLPASVIALYCTYLCYSGLSSEPRDYECN-G   271
NP_001016331.1     250   IVSVISILPKVQEHQPRSGLLQSSVITLYTMYLTWSSMSNEP-DRSCNPS   298


NP_006802.1        299   LMSFITRITAPTLAP---GNSTAVV----PTPTPPSKSGSLLDSDNFIGL   341
XP_001152172.1     299   LMSFITRITAPTLAP---GNSTAVV----PTPTPLSKSGSLLDSDNFIGL   341
XP_001110325.1     299   LMSFITRITAPTLAP---GNSTAVV----PTPTPLSKSGSLLDSDNFIGL   341
XP_534427.3        299   LWTIVTHMTAPTLAP---GNSTAIV----PTSAPPSKGGHFIDLENFIGL   341
NP_001076881.1     298   LLSIITHMTSSTLAP---ANTTAPA----PTPAVPLQSGPSLNKENFIGL   340
NP_036162.3        299   LMSIITHLTSPTVSP---ANSTTLA----PAYAPPSQSGHFMNLDDIWGL   341
NP_001008313.1     299   LMSIITQLTSPTVSP---ANSTTPA----PAYVPPSQNGHFINLDDLGGL   341
NP_001006291.1     299   LLNIITQIATPTIAP---ANTTVIP----ATPAPP-KSLQWWDAQSIVGL   340
XP_003199457.1     297   LLSIIQQITSTTVAPLEIENQTAVIIIDLEETVPTAPYLRWWDAQSIVGL   346
NP_001185008.1     272   LHNHSKAVSTGTMT---------------------------------IGL   288
NP_001048364.1     272   LHNHSKAVSTGSLS---------------------------------LGL   288
NP_001016331.1     299   LLSIISTINSPAIIP---SNETILE----PTPEPI-KALQWWDSQNIIGF   340


NP_006802.1        342   FVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVI--LGDTTTSGASDEEDGQ   389
XP_001152172.1     342   FVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVI--LGDTTTSGASDEEDGQ   389
XP_001110325.1     342   FVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVI--LGDTTTNGASDEEDGQ   389
XP_534427.3        342   TGFVLCLLYSSIRTSNNSQVSKLTLSGSDSVI--LRDTAANGGSDEEDGQ   389
NP_001076881.1     341   LVFVLSLSYSSIRNSSNSQVSKLTLSGSDSVI--LRDTAANGASDEEDGR   388
NP_036162.3        342   IIFVFCLIYSSFRTSSNSQVNKLTLSGSDSVI--LGDT-TNGANDEEDGQ   388
NP_001008313.1     342   TIFVICLIYSSIRTSSNSQVNKLTLSGSDSVI--LGDT-TNGASDEEDGR   388
NP_001006291.1     341   VIFVFCLLYSSIRSSSNSQVNKLILSASDSAI--LEEAGGTGSGAAEEGE   388
XP_003199457.1     347   AIFVLCILYSSIRSSNTSQVNKLTLAAKDATV--QDESAASSAEAAEENT   394
NP_001185008.1     289   LTTVLSVVYSAVRAGSSTTL----LSPPDSPR--AEKPLLPIDGKAEEKE   332
NP_001048364.1     289   LTTILSVVYSAVRAGSSATV----LSAPDSPRAGADKPLLPFSKADEEAE   334
NP_001016331.1     341   ILFVACLMYSSIRNTTNSQVNKLTLSSNDTVI--LDDT--TGSSDAEDGE   386


NP_006802.1        390   PRRAV-DNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTS   438
XP_001152172.1     390   PRRAV-DNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTS   438
XP_001110325.1     390   PRRAV-DNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTS   438
XP_534427.3        390   PRRAV-DNEKEGVQYSYFLFHFMLSLASLYIMMTLTSWYSPDAEFQSMTS   438
NP_001076881.1     389   PRRAV-DNEREGVQYNYSMFHLMLCSASLYIMMTLTNWYSPDANFQSMTS   437
NP_036162.3        389   PRRAV-DNEKEGVQYSYSFFHLMLCCASLYIMMTITSWYSPDAKFQKVSS   437
NP_001008313.1     389   PRRAV-DNEKDGVQYNYSFFHLMLCCASLYIMMTITSWYSPDAKFQKVSS   437
NP_001006291.1     389   VRRVM-DNEKDGVQYNYAFFHFMLFLASLYIMMTLTNWYSPDADFKTMTS   437
XP_003199457.1     395   TAHHMEDNERETVQYSYAFFHFMLFLASLYIMMTLTNWYSPDTDYNAMRS   444
NP_001185008.1     333   EK----ENKKP-VSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVD   377
NP_001048364.1     335   KK----DVPRP-VTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVD   379
NP_001016331.1     387   VKRVI-DNEKDGVQYNYSLFLFMLCLSSLYIMMTLTNWYSPTADTKTMTS   435


NP_006802.1        439   -KWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS   473
XP_001152172.1     439   -KWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS   473
XP_001110325.1     439   -KWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS   473
XP_534427.3        439   -KWPAVWVKISSSWVCLLLYVWTLVAPLVLTNRDFS   473
NP_001076881.1     438   -KWPAVWVKISSSWVCLLLYVWTLVAPLVLTNRDFS   472
NP_036162.3        438   -KWLAVWFKMGSSWLCLLLYLWTLVAPLVLTGRDFS   472
NP_001008313.1     438   -ERLAVWVKMGSSWVCLLLYLWTLVAPLVLTGRDFS   472
NP_001006291.1     438   -KWPAVWVKITSSWVCLLLYLWTLVAPLVLTNRDFS   472
XP_003199457.1     445   -KWPAVWVKISSSWVCLTLYTWSLIAPMILPNRDFT   479
NP_001185008.1     378   VGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF-   412
NP_001048364.1     380   VGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF-   414
NP_001016331.1     436   -TWPAVWFKISSSWVCLLLYFWTLIAPIVLSNRDFS   470


Protein Acc. Gene Organism
NP_006802.1 SERINC3 H.sapiens
XP_001152172.1 SERINC3 P.troglodytes
XP_001110325.1 SERINC3 M.mulatta
XP_534427.3 SERINC3 C.lupus
NP_001076881.1 SERINC3 B.taurus
NP_036162.3 Serinc3 M.musculus
NP_001008313.1 Serinc3 R.norvegicus
NP_001006291.1 SERINC3 G.gallus
XP_003199457.1 LOC100535683 D.rerio
NP_001185008.1 AT1G16180 A.thaliana
NP_001048364.1 Os02g0792900 O.sativa
NP_001016331.1 serinc3 X.tropicalis


Support Center