Display Settings:

Format

Send to:

Choose Destination
HomoloGene:3819. Gene conserved in Amniota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_005204.1          1   MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAG   50
XP_001166441.1       1   MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAG   50
XP_001112115.1       1   MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNQSYEKLEAVEYKTQVVAG   50
XP_545130.3          1   MMPGGLTEAKPATPEVQEIANEVKPQLEEKTNETYQEFEAVEYKTQVVAG   50
NP_001161296.1       1   MIPGGLTEAKPATPEIQEIANMVKPQLEEKTNETYEEFTAIEYKTQVVAG   50
NP_001028411.1       1   MIPGGLTEARPATAEVQEIADRVKAQLEEETNEKYEIFKAVEYKTQVVAG   50
NP_001076016.1       1   MMPGGLSRARSATPEIQEIADKVKSLLEEKTNEKYEVFKAVEYKSQVVAG   50
NP_084009.1          1   MMPGGLSRARSATPEIQEIANKVKSLLEEKTNEKYEVFKAVEYKSQVVAG   50
NP_001099346.1       1   MMPGGLTPARPATPEIQEIANEVKAQLEEQTNKKYEKFEAVEYKTQVVAG   50
XP_416493.3          1   MMTGGLSDPKPATAEVQHLADQVKPQLESRENKTYQTFTAIIYRTQVVAG   50


NP_005204.1         51   TNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF   98
XP_001166441.1      51   TNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF   98
XP_001112115.1      51   INYYIKVRAGDNHYMHLKVFKSLPGQNEDLVLTGYQADKNKDDELTGF   98
XP_545130.3         51   INYYIKVRVGDNSYIHLKIFKGLPGQNPTLTLTGYQTDKSKDDELTGF   98
NP_001161296.1      51   INYYIKIQTGDNRYIHIKVFKSLPQQSHSLILTGYQVDKTKDDELAGF   98
NP_001028411.1      51   VNYFIKMDVGGGCFTHIKVFKDLSGKN-NLELTGYQTNKTEDDELTYF   97
NP_001076016.1      51   QNYFIKMDVGGGCFLHIKVFKGISGEN-VLELHGYQTNKTRKDELSYF   97
NP_084009.1         51   QNYFIKMDVGGGCFLHIKVFTGISGEN-VLELSGYQTNKTRKDELSYF   97
NP_001099346.1      51   INYFIKMDVGHDCFTHIKVFKGLSENS-DLKLTGYQTNKTKNDELAYF   97
XP_416493.3         51   TNYFIKVQISDE-YIHLKIFQPLPHENQHPSLTGYQTGKTRDDPLVYF   97


Protein Acc. Gene Organism
NP_005204.1 CSTA H.sapiens
XP_001166441.1 CSTA P.troglodytes
XP_001112115.1 CSTA M.mulatta
XP_545130.3 CSTA C.lupus
NP_001161296.1 CSTA B.taurus
NP_001028411.1 Csta M.musculus
NP_001076016.1 Gm5483 M.musculus
NP_084009.1 2010005H15Rik M.musculus
NP_001099346.1 Csta R.norvegicus
XP_416493.3 CSTA G.gallus


Support Center