Display Settings:

Format

Send to:

Choose Destination
HomoloGene:37608. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002297.2          1   --------MADNF-------------SLHDALS-----------------   12
XP_001148424.2       1   --------MADNF-------------SLHDALS-----------------   12
XP_002805130.1       1   --------MADNF-------------SLHDALS-----------------   12
NP_001183972.1       1   --------MADSF-------------SLNDALS-----------------   12
NP_001095811.1       1   --------MADGF-------------SLNDALS-----------------   12
NP_001139425.1       1   --------MADSF-------------SLNDALA-----------------   12
NP_114020.1          1   --------MADGF-------------SLNDALA-----------------   12
NP_999756.1          1   MQAMKARCWQPHWMLPLLPLSSPLHPQLSDALP-----------------   33
XP_704272.2          1   --------MAD-F-------------SLADAIPDDVPSEASKNKHTNPSA   28
NP_988986.1          1   --------MADDF-------------SLEEALPSQSAANAQHSQ------   23


NP_002297.2         13   --------------G--SGNPN-------------PQGWPGAWGNQPAGA   33
XP_001148424.2      13   --------------G--SGNPN-------------PQGWPGAWGNQPAGA   33
XP_002805130.1      13   --------------G--SGNPN-------------PQGWPGPWGNQPAGA   33
NP_001183972.1      13   --------------G--SGNPN-------------PQGWPGPWGNQPAGA   33
NP_001095811.1      13   --------------G--SGKPN-------------PQGWPGSWGNQPAGA   33
NP_001139425.1      13   --------------G--SGNPN-------------PQGYPGAWGNQP-GA   32
NP_114020.1         13   --------------G--SGNPN-------------PRGWPGAWGNQP-GA   32
NP_999756.1         34   --------------AHNPGAPP-------------PQGW-----NRPPGP   51
XP_704272.2         29   PGNGAPPPTNPGWPGAAPGGPHFPPSGGPVQPAGFPQTWPSAPGSFPPGP   78
NP_988986.1         24   --------------GQEQGQPP-------------QQPW--QWGNPPPGQ   44


NP_002297.2         34   GG---YPG-ASYPGAYPGQ-APPGAYP-------------G-----QAPP   60
XP_001148424.2      34   GG---YPG-ASYPGAYPGQ-APPGAYP-------------R-----QAPP   60
XP_002805130.1      34   GG---YPG-ASYPGAYPGQ-APPGVYP-------------G-----QAPP   60
NP_001183972.1      34   GG---YPG-ASYPGAYPGQ-APPGGYP-------------G-----QAPP   60
NP_001095811.1      34   GG---YPG-AAYPGAYPGQ-APPGPYP-------------G-----QGPP   60
NP_001139425.1      33   GG---YPG-AAYPGAYPGQ-APPGAYP-------------G-----QAPP   59
NP_114020.1         33   GG---YPG-ASYPGAYPGQ-APPGGYP-------------G-----QAPP   59
NP_999756.1         52   GA---FPAYPGYPGAYPG---APGPYP-------------GAPGPHHGPP   82
XP_704272.2         79   GAPGQFPGAPAAPGQFPGAPAAPGGYPPGPGVPGQFPPNPGAPGQFPSMP   128
NP_988986.1         45   YP---FPG--PYPG-YPGA-APSQQYP-------------G---------   65


NP_002297.2         61   GAYPG---------------APG--------------------------A   69
XP_001148424.2      61   GAYPG---------------APG--------------------------A   69
XP_002805130.1      61   GAYPG---------------APG--------------------------A   69
NP_001183972.1      61   GGYPGQAPPGGYPGQA----PPGGYPGQAPPGGYPGQAPPGTYPGPTAPA   106
NP_001095811.1      61   GAYPGQGPPGAYPGQG----PPG------------------AYPGPTAPA   88
NP_001139425.1      60   GAYPGQAPPSAYPGPT----APG--------------------------A   79
NP_114020.1         60   SAYPGPTGPSAYPGPT----APG--------------------------A   79
NP_999756.1         83   GPYPG-GPPGPYPG-G----PPG--------------------------P   100
XP_704272.2        129   GQFPPGGAPMPYPVPGQFPSPPG----------------APQGPNPNVPY   162
NP_988986.1         66   -PFPG----QQYPGFP----PPG-------------------------QG   81


NP_002297.2         70   YPGAPAPGVYPGPPSGPGAYP---------------SSGQ----------   94
XP_001148424.2      70   YPGAPASGVYPGPPSGPGAYP---------------SSGQ----------   94
XP_002805130.1      70   YSG--ASGVYPGPPSGAGAYP---------------SPGQ----------   92
NP_001183972.1     107   YPGPTAPGTQPGQPSGPGAYP---------------PPGQ----------   131
NP_001095811.1      89   YPGPTAPSAYP----GPGAYP---------------PPAQ----------   109
NP_001139425.1      80   YPGPTAPGAYPGST-APGAFPGQ-----------PGAPGA----------   107
NP_114020.1         80   YPGPTAPGAFPGQPGGPGAY--------------PSAPGA----------   105
NP_999756.1        101   YPGGP-PGPYPGGPTAP--YSEA-----------PAAPLVTALSYFKGFC   136
XP_704272.2        163   PPGPSGPGMY--GPGGPGAFPPDGGPGYGGGMFPPVPPGSWGQPGGGFPA   210
NP_988986.1         82   YPGFPAPG--QGNPGFPAQDPQK-----------PGAPGQ----------   108


NP_002297.2         95   -PSATGAYPAT--GPYGA--------------------------------   109
XP_001148424.2      95   -PSAPGAYPAT--GPYGA--------------------------------   109
XP_002805130.1      93   -PSAPGAYPAT--GPYGA--------------------------------   107
NP_001183972.1     132   -PSAPGAYPAA--GPFGI--------------------------------   146
NP_001095811.1     110   -PSAPGAYPAA--GPYGI--------------------------------   124
NP_001139425.1     108   YPSAPGGYPAA--GPYGV--------------------------------   123
NP_114020.1        106   YPSAPGAYPAT--GPFGA--------------------------------   121
NP_999756.1        137   FSSSSLCLAMG--GTWGCVSLGGCMSSHIAVMSTPSPCLTVRPVLLANVL   184
XP_704272.2        211   HPGPPGGYGPGPMGPYGG--------------------------------   228
NP_988986.1        109   -PE----YPA----------------------------------------   113


NP_002297.2        110   ------PAGP--LIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQR   151
XP_001148424.2     110   ------PAGP--LIVPYNLPLPGGVVPRMLITILGSVKPNANRIALDFQR   151
XP_002805130.1     108   ------PAGP--LSVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFKR   149
NP_001183972.1     147   ------PAGP--LTVPYDLPLPGGVKPRMLITILGTVRPSANRLALDFKR   188
NP_001095811.1     125   ------PSGP--LNVPYDLPFPGGIRPRMLITILGTVKPNANRLALDFKR   166
NP_001139425.1     124   ------PAGP--LTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRR   165
NP_114020.1        122   ------PTGP--LTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKK   163
NP_999756.1        185   FCLTPNPCPL--QKVPYDLPLPAGLMPRLLITITGTVNSNPNRFSLDFKR   232
XP_704272.2        229   ------PAAPGGMPLPYDLPLRAGIMPHLLITIVGEPIIGGDRFHVDFMR   272
NP_988986.1        114   ------PSALVQLKVPYELPLPSGVVHRLVITIHGTVNPNAKRFAIDFRR   157


NP_002297.2        152   GNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSV-FPFESGKPFKI   200
XP_001148424.2     152   GNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSV-FPFESGKPFKI   200
XP_002805130.1     150   RNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSV-FPFESGKPFKI   198
NP_001183972.1     189   GNDVAFHFNPRFNEDNKRVIVCNTKLDNIWGKEERQAA-FPFESGKPFKI   237
NP_001095811.1     167   GNDVAFHFNPRFNEDNRRVIVCNSKLNNNWGKEERQMV-FPFESGKPFKI   215
NP_001139425.1     166   GNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSA-FPFESGKPFKI   214
NP_114020.1        164   GNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSA-FPFESGKPFKI   212
NP_999756.1        233   GQDIAFHFNPRFKEDHKRVIVCNSMFQNNWGKEERTAPRFPFEPGTPFKL   282
XP_704272.2        273   GHEVVFHFNPRFHEN---TVVRNSQLGGLWGPEEREGG-FPFVQGRQFEL   318
NP_988986.1        158   GHDIAMHINPRFDE-RPHVIVRNSMIHNKWGHEERHAQKFPFVAGQPFKL   206


NP_002297.2        201   QVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI   250
XP_001148424.2     201   QVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLAISGDIDLTSASYTMI   250
XP_002805130.1     199   QVLVESDHFKVAVNDAHLLQYNHRVKQLNEISQLGISGDIDLTNASYTMI   248
NP_001183972.1     238   QVLVESDHFKVAVNDAHLLQYNHRMKNLPEISKLGISGDIDLTSASYAMI   287
NP_001095811.1     216   QVLVEPDHFKVAVNDAHLLQYNHRVKNFGEISTLGISGDITLTSASHTMI   265
NP_001139425.1     215   QVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI   264
NP_114020.1        213   QVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI   262
NP_999756.1        283   QVLCEGDHFKVAVNDAHLLQFNFREKKLNEITKLCIAGDITLTSVLTSMI   332
XP_704272.2        319   KILVETDGFKVAVDGVHLLEFEHRTGGMEDVTRLRIDGDVTLFSAAPSMI   368
NP_988986.1        207   QVMCEADHYKVAINNETLFQYVHRVKELHEIRSVCIAGDVTLNEVTPSMA   256


NP_002297.2              
XP_001148424.2           
XP_002805130.1           
NP_001183972.1           
NP_001095811.1           
NP_001139425.1           
NP_114020.1              
NP_999756.1              
XP_704272.2              
NP_988986.1              


Protein Acc. Gene Organism
NP_002297.2 LGALS3 H.sapiens
XP_001148424.2 LGALS3 P.troglodytes
XP_002805130.1 LGALS3 M.mulatta
NP_001183972.1 LGALS3 C.lupus
NP_001095811.1 LGALS3 B.taurus
NP_001139425.1 Lgals3 M.musculus
NP_114020.1 Lgals3 R.norvegicus
NP_999756.1 LGALS3 G.gallus
XP_704272.2 si:ch211-67f24.5 D.rerio
NP_988986.1 lgals3 X.tropicalis


Support Center