Display Settings:

Format

Send to:

Choose Destination
HomoloGene:35370. Gene conserved in Tetrapoda Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001096123.1           --------------------------------------------------
XP_003310585.1           --------------------------------------------------
XP_001095354.1       1   MEAAVGVPDGGDQ---GGAGPREDATPMDAYLRKLGLYRKLVAKDGSCLF   47
XP_532680.3          1   MEAAVGTPDGVDR---GGAGPREDATPMDAYLRKLGLYRKLVAKDGSCLF   47
NP_001230240.1       1   ---------------------------MDAYLRTLGLYRKLVAKDGSCLF   23
NP_001074633.1       1   MEAAVGAPDGVDQ---GGVGPLEDETPMDAYLRKLGLYRKLVAKDGSCLF   47
NP_001178629.1       1   MEAAVGAPDGVDQ---GGAGPLEDATPMDAYLRKLGLYRKLVAKDGSCLF   47
XP_420427.3          1   -MEAAGKPGGGEQSRCAGGTDAPAAASMDCYLRSQGLYRKKVAKDGSCLF   49
NP_001072598.1       1   MDGQGGK---------GTVAHSKDEAAMDSYLRSEGLYRKKIAKDGSCLF   41


NP_001096123.1       1   ------------------MACIHYLRENREKFEAFIEGSFEEYLKRLENP   32
XP_003310585.1       1   ------------------MACIHYLRENREKFEAFIEGSFEEYLKRLENP   32
XP_001095354.1      48   RAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENP   97
XP_532680.3         48   RAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENP   97
NP_001230240.1      24   RAVAEQVLHSQSRHVEVRMACIHYLRENREKFEEFIEGSFEEYLKRLENP   73
NP_001074633.1      48   RAVAEQVLHSQSRHVEVRMACIRYLRENREKFEAFIEGSFEEYLKRLENP   97
NP_001178629.1      48   RAVAEQVLHSQSRHVEVRMACIRYLRDNREKFEAFIEGSFEEYLKRLENP   97
XP_420427.3         50   RAVAEQVLHSQSRHIDVRMACVDYLRKHREKFEAFIEGPFEEYLKCLENP   99
NP_001072598.1      42   RAVAEQVMHSQSEHLKIRKSCINYLRKNRGQYEALIEGSFEDYLKSLENP   91


NP_001096123.1      33   QEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGN   82
XP_003310585.1      33   QEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGN   82
XP_001095354.1      98   QEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGN   147
XP_532680.3         98   QEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGN   147
NP_001230240.1      74   QEWVGQVEISALSLMYRKDFIIYQKPNVSPSQVTENNFPEKVLLRFSNGN   123
NP_001074633.1      98   QEWVGQVEISALSLMYRKDFVIYQEPNVSPSHVTENNFPEKVLLCFSNGN   147
NP_001178629.1      98   QEWVGQVEISALSLMYRKDFVIYQEPNVSPSHVTENNFPEKVLLCFSNGN   147
XP_420427.3        100   QEWVGQVEISALSLMYKKDFIIYREPNASPSHVTENGFSDKVLLCFSNGN   149
NP_001072598.1      92   QEWVGQVEISALSLMFKKDFIIYQEPNVPPACVTENGFSEKIMLCFSNGN   141


NP_001096123.1      83   HYDIVYPIKYKESSAMCQSLLYELLYEKVFKTDVSKIVMELDTLEVADED   132
XP_003310585.1      83   HYDIVYPIKYKESSAMCQSLLYELLYEKVFKTDVSKIVMELDTLEVADED   132
XP_001095354.1     148   HYDIVYPIKYKESSAMCQSLLYELLYEKVFKTDVSKIVMGLDTLEVADED   197
XP_532680.3        148   HYDIVYPIKYKENSAMCQSLLYELLYEKVFKTDVSKILMGLDPSEVADEN   197
NP_001230240.1     124   HYDIVYPIKYKESSAMCQSLLYELLYEKVFKTDVSKILMGLYSSEVSDED   173
NP_001074633.1     148   HYDIVYPITYKDSSAMCQSLLYELLYEKVFKTDVSKIMMGLEASEVAEES   197
NP_001178629.1     148   HYDIVYPITYRDSSAVCQSLLYELLYEKVFKTDVSKIMMGLETSEVADES   197
XP_420427.3        150   HYDIVYPIEYSERAALCQSLLYELLYEKVFGTDVKKIIAELSAVGVTEEN   199
NP_001072598.1     142   HYDIIYPIGFAESAAMCQSIIYELLYEKVMGVNVGKYMVEQDTCGPNATG   191


NP_001096123.1     133   NS----EISDSEDDSCKSKTAAAAADVNGFKPLSGNEQLKNNGNSTSLPL   178
XP_003310585.1     133   NS----EISDSEDDSCKSKTAAAAADVNGFKPLSGNEQLKNNGNSTSLPL   178
XP_001095354.1     198   NS----EISDSEDDSCKSKT-AAAADVNGFKPLSDNEQLKNNGNSTSLPL   242
XP_532680.3        198   NS----EISDSEDDSCKSKT-TTANDVNGVKALSSDQHPKNNGNSSSLPL   242
NP_001230240.1     174   NS----EISNSEDDSCKSKP-TTINDVNGFKTLSSDQHPKSNGNSPSLPL   218
NP_001074633.1     198   NS----EISDSEDDSCKSKS-TAATDVNGFKP-SGSENPKNNGNSADLPL   241
NP_001178629.1     198   NS----EISDSEDDSCKSKS-TAATDVNGFKS-SGSENPKNHGNSADLPL   241
XP_420427.3        200   NGSSEFSASDSEDDNYRSKA-TAVGDVNGLKSLSGSKHLKSSGNPT---L   245
NP_001072598.1     192   EVYCS-DGSGSEGEDVSKNIKTNFADMNGFKPHKDDKCPQKKKEEPT--M   238


NP_001096123.1     179   SRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCQVR   228
XP_003310585.1     179   SRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCQVR   228
XP_001095354.1     243   SRKVLKSLNPSVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCQVR   292
XP_532680.3        243   SRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCQVR   292
NP_001230240.1     219   SRKVLKSLSPAVYRNVEYEIWLKSKQAQQKHDYSIAAGLQYEVGDKCQVR   268
NP_001074633.1     242   SRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCHVR   291
NP_001178629.1     242   SRKVLKSLSPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEGGERCHVR   291
XP_420427.3        246   PKKVLKSLNPLVYRNVEYDVWLQSKWDQQKQDFSIAAGMQYSIGDKCKVR   295
NP_001072598.1     239   LPSVLRSLHTTQYRNVEYEVWLKTQRDQQKLDFSIAAGMQYSVGDKCQVR   288


NP_001096123.1     229   LDHNGKFLNADVQGIHSENGP--VLVEELGKKHTS--KNLKA-----PPP   269
XP_003310585.1     229   LDHNGKFLNADVQGVHSENGP--VLVEELGKKHTS--KNLKA-----PPP   269
XP_001095354.1     293   LDHNGKFLNADVQGVHSENGP--VLVEELGKKHTS--KNLKA-----PPP   333
XP_532680.3        293   LDHNGKFSNADFPGVHSENGP--VLVEELGKKHSP--KNLKP-----PPS   333
NP_001230240.1     269   LDHDGKFSNADFQGVHAENGP--VLVAELGKKYSP--KNLKP-----PAS   309
NP_001074633.1     292   LDHNGKLSNADIHGVHSENGL--VLSEELGKKHTP--KNLKP-----PPP   332
NP_001178629.1     292   LDHNGKLSNADIHGVHSENGP--VLSEELGKKQTP--KNLKP-----PPP   332
XP_420427.3        296   LDHNGKFYNAHIQEVCSENGPVVVFVEELGAKHSVSLKSLKPLPQA-SPM   344
NP_001072598.1     289   VEPGGKFYNAHIQEVGTETGPVIVFVEELGEKHAVQLKHLKPIPQTIIST   338


NP_001096123.1     270   ESWNTVSGKKMKK--PSTSGQNFHSDVDYRGPKNPSKPIKAPSALPPRLQ   317
XP_003310585.1     270   ESWNTVSGKKMKK--PSTSGQNFHSDVDYRGPKNPSKPIKAPSALPPRLQ   317
XP_001095354.1     334   ESWNTVSGKKMKK--PSTSGQNFHSDMDYRGPKNPSKPIKAPSALPPRLQ   381
XP_532680.3        334   ESWNTVSGKKMRK--PSTSGQNFHSDMDYRGPKNPSKPIKTPSALPPRLQ   381
NP_001230240.1     310   ESWNTVSGKKMKK--PP-SGQNFHSDMDYRGPKNSSKPIKAPSALPPRLQ   356
NP_001074633.1     333   ESWNTVSGKKMKK--PN-SGQNFHSDTDYRGPKNLNKPIKAPSALPPRLQ   379
NP_001178629.1     333   ESWNTVSGKKMKK--PN-SGQNFHSDTDYRGPKNLNKPIKAPSALPPRLQ   379
XP_420427.3        345   EGWNTVPGKKMKKFFPT-WGQNAQPDADGRGPKNQSKSIKPQSALPPRLQ   393
NP_001072598.1     339   EGWNTVAGKKQKKALP--SGTNAQTEKDYRGQKGFGKPVKQQAAQPLRQQ   386


NP_001096123.1     318   HP-SGVRQHAFSSHSSGSQSQKFSSEHKNLSRTPSQII-RKPDRERVEDF   365
XP_003310585.1     318   HP-SGVRQHAFSSHSSGSQSQKFSSEHKNLSRTPSQII-RKPDRERVEDF   365
XP_001095354.1     382   HP-SGVRQHAFSSHSSGSQSQKFSSEHKNLSRTPSQII-RKPDRERVEDF   429
XP_532680.3        382   HP-SGVRQHTFSSHSAGSQSQKPSSEHKNLNRTPSQII-RKPDRERAEDF   429
NP_001230240.1     357   HP-SGARQHASSGHSAAPQSQKTSSEHKNLSRTPSQII-RKPDRERAEDF   404
NP_001074633.1     380   HPSSGVRQHAFSSHSTGSQSQKSSSEHKNLSRMPSQIT-RKPDRERAEDF   428
NP_001178629.1     380   HPPAGVRQHALSSHSTGPQSQKSSSEHKNLSRVPSQIT-RKPDRERAEDF   428
XP_420427.3        394   HT-VGTRQHQFV--CSGPQPHQTSTEQKAPGRNSSQAA-RKPDRERTEDL   439
NP_001072598.1     387   QA-AGNKQYGLSSQLSDQAPQ---SENKGRSKTPPKVPGRKVERERSENV   432


NP_001096123.1     366   DHTSRESNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSS-SVN   414
XP_003310585.1     366   DHTSRESNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSS-SVS   414
XP_001095354.1     430   DHTSRESNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSS-SVS   478
XP_532680.3        430   DHTSRESNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSS-SVS   478
NP_001230240.1     405   DATTREPNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSS-SVS   453
NP_001074633.1     429   DHVSRESYYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSS-SVS   477
NP_001178629.1     429   DHVSRESYYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSS-SVS   477
XP_420427.3        440   NHGGRDCNYFGLSPEERREKQAIEESRSLYEIQQRDEQAFPALSNNQSVS   489
NP_001072598.1     433   T--------FGLTVEERKEKEAIEESKSLYEMQSMDKDAFPALSSL-PIG   473


NP_001096123.1     415   QSASQSSNPCVQRKSSHVGDRKGSRRRMDTEERKDKDSIHGHSQLDKRPE   464
XP_003310585.1     415   QSASQSSNPCVQRKSSHVSDRKGSRRRMDTEERKDKDSIHGHSQLDKRPE   464
XP_001095354.1     479   QSASQSSNPCVQRKSSHVSDRKGSRRRMDTEERKDKDSIHGHSQLDKKPE   528
XP_532680.3        479   QSASPSSNPCVQRKSSHVSDRKGSRRRMDTEERKDKDSIHGHTHLDKKPE   528
NP_001230240.1     454   QSASQSSNPGVQRKSSHGSDRKGSRRRMDTEERKDKDSVHGHISLDKKPE   503
NP_001074633.1     478   QSPSQNSNACVPRKSSHARDRKGSMRRADAEERKDKDSLRGHTHVDKKPE   527
NP_001178629.1     478   QSP-QNSNACVPRKSSHARDRKGSMRRVDAEERKDKDSLRGHTHMDKKPE   526
XP_420427.3        490   QAATRTVD---NPKKVSSNEKRSSKWTAEVEEQKDKESNSRQIHLSQKLE   536
NP_001072598.1     474   ERAVQNTE-VFPVKRIPNVITENTRRKSEGEDQRDKASTAQAT-------   515


NP_001096123.1     465   PSTLE-NITDDKYATVSSPSKSKKLECPSPAEQKPAEHVSLSNPAPLL-V   512
XP_003310585.1     465   PSTLE-NITDDKYATVSSPSKSKKLECPSPAEQKPAEHVSLSNPAPLL-V   512
XP_001095354.1     529   PSTLE-NITDDKYATVSSPSKSKKLECPSPAEQKPAEHVSLSNPAPLL-V   576
XP_532680.3        529   PSTLE-NISDDKCARISSPSKSKKLECP-PVEQKPAEHVSLSNPAPLL-V   575
NP_001230240.1     504   PGTLE-NIGNDKCARISSPSKSKKLECPPPTEQKPAEHVSLSNPAPLL-V   551
NP_001074633.1     528   PSTLE--ISDDKCTRVSSPSKSKK-ECPSPVEQKPAEHIPLSNPAPLL-V   573
NP_001178629.1     527   PSTLE--ISDDKCTRVSSPSKSKK-ECPSPVEQKPAEHIPLSNPAPLL-V   572
XP_420427.3        537   PNSSERNSQDESCPKASSPLEQVKTDSPAVAEQKLTECLPSVTPTPSP-V   585
NP_001072598.1     516   ------KGRDQKC-------------CDETVKQLTSSDADDLPSMPVLRT   546


NP_001096123.1     513   SPEVHLTPAVPSLPATVPAWPSEPTTFGPTGVPAPIPVLSVTQTLTTGPD   562
XP_003310585.1     513   SPEVHLTPAVPSLPATVPAWPSEPTTFGPTGVPAPIPVLSVTQTLTTGPD   562
XP_001095354.1     577   SPEVHLTPAVPSLPATVPAWPSEPTTFGPTGVPAPIPILSVTQTLTTGPD   626
XP_532680.3        576   SPEVHLTPAVPSLPATVPAWPSEPTTFGPTGVPAQIPVLSVTQTLTTGPD   625
NP_001230240.1     552   SPEVHLTPAVPSLPATVPAWPSEPTTFGPTGVPAQIPVLSVTQTLTTGPD   601
NP_001074633.1     574   SPEVHLTPAVPSLPATVPAWPSEPTTFGPTGVPAQIPILSVTQ--TTGPD   621
NP_001178629.1     573   SPEVHLTPAVPSLPATVPAWPSEPTTFGPTGVPAQIPILSVTQ--TTGPD   620
XP_420427.3        586   FSEVHLPPTVPSVPAIVPAWPSEPTTYGPAGIPAQIPASSLMPAPATGPD   635
NP_001072598.1     547   SAEHQASPIVPSTPSVVTSWP---------GIPAQIPSMS-----ATGSD   582


NP_001096123.1     563   SAVSQAHLTPS---PVPVSIQAVNQPLMPLPQTLSLYQDPLYPGFPCNEK   609
XP_003310585.1     563   SAVSQAHLTPS---PVPVSIQAVNQPLMPLPQTLSLYQDPLYPGFPCNEK   609
XP_001095354.1     627   SAVSQAHLTPS---PVPVSIQAVNQPLMPLPQTLSLYQDPLYPGFPCNEK   673
XP_532680.3        626   SAVSQAHLTPS---PVPVSIQAVNQPLMPLPQTLSLYQDPLYPGFPYNEK   672
NP_001230240.1     602   SAVSQAHLTPS---PVPVSIQAVNQPLMPLPQTLSLYQDPLYPGFPCNEK   648
NP_001074633.1     622   AAVSQAHLTPS---PVPVSIQAVNQPLMPLPQTMSLYQDPLYPGFPCSEK   668
NP_001178629.1     621   AAVSQAHLTPS---PVPVSIQAVNQPLMPLPQTMSLYQDPLYPGFPCSEK   667
XP_420427.3        636   SIVSQA-------------------------QTLNPYQDPLYPGFPLSEK   660
NP_001072598.1     583   SSVLQPQVTSSPYPPLPVSVPAVNQPLLPLPQTLSALQDPLYPGFPLNEK   632


NP_001096123.1     610   GDRAIVPPYSLCQTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   659
XP_003310585.1     610   GDRAIVPPYSLCQTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   659
XP_001095354.1     674   GDRAIVPPYSLCQTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   723
XP_532680.3        673   GDRAIAPPYSLCHTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   722
NP_001230240.1     649   GDRAIAPPYSLCHTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   698
NP_001074633.1     669   GDRAIAPPYSLCQTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   718
NP_001178629.1     668   GDRAIAPPYSLCQTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   717
XP_420427.3        661   GERAIAPSYSLCSSGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPL   710
NP_001072598.1     633   GERATVPSYSFCKNGGDLPDDKSILRFFFNLGLKAYTYPMWPPHTHLYPL   682


NP_001096123.1     660   HQAYLAACRMYPKVPVPVYPHNPWFQEAPAAQNESDCTCTDAHFPMQTEA   709
XP_003310585.1     660   HQAYLAACRMYPKVPVPVYPHNPWFQEAPAAQNESDCTCTDAHFPMQTEA   709
XP_001095354.1     724   HQAYLAACRMYPKVPVPVYPHNPWFQEAPAAQNESDCACTDAHFPMQTEA   773
XP_532680.3        723   HQAYLAACRMYPKVSVPVYPPNPWFQEAPSAQNEGDCTCTDAHFPMQTEA   772
NP_001230240.1     699   HQAYLAACRMYPKVPVPMYPQNPWFQEPPSAQNESDCTCPDAHFPMEPEG   748
NP_001074633.1     719   HQAYMAACRMYPKVPVPVYPQNTWFQEAPPAQSESDCPCTDAHYSLHPEA   768
NP_001178629.1     718   HQAYMAACRVYPKVPVPVYPQSTWFQEAPPAQSESDCPCADAHYSMHPEA   767
XP_420427.3        711   HQAYLAACRMYPNMSLPVYPHNPWFQEAPPTQIENETVQPNRHFAIPSET   760
NP_001072598.1     683   HQAYLNMCRMYPN--IPVYPQGSWVQETSENQSEVD----PSLLSHPSEV   726


NP_001096123.1     710   SVNGQMPQPEIGPPTFSSPLVI--PPSQVSESHGQLSYQADLESETPGQL   757
XP_003310585.1     710   SVNGQMPQPEIGPPTFSSPLVI--PPSQVSENHGQLSYQADLESETPGQL   757
XP_001095354.1     774   SVNGQMPQPEIGPPTFSSPLVI--PPSQVSESHGQLSYQADLESETPGQL   821
XP_532680.3        773   TVNGQMPQAEIGPPTFSSPLVI--PPSQVSESHGQLSYQADIESENSGQL   820
NP_001230240.1     749   SVNGQMPQAEMGPPAFSSPLVM--PPSQVSDSHGQLSYPADLESENAGQL   796
NP_001074633.1     769   SVNGQMPQAEMGPPAFASPLVI--PPSQVSEGHGQLSYQPELESENPGQL   816
NP_001178629.1     768   SVNGQMPQAEIGPPAFSSPLVI--PPSQVSEGHGQLSYQPELESESPGQL   815
XP_420427.3        761   RSNGQMSQVDSRSPSL--PLIV--PAAQVSESQGQLR----VESENSVQA   802
NP_001072598.1     727   RMESQGSQ----------PLTVSSSPVQVPGIVGQIPNQSESGVINQALH   766


NP_001096123.1     758   LHADYEESLSGKNMFPQPSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFIE   807
XP_003310585.1     758   LHADYEESLSGKNMFPQPSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFIE   807
XP_001095354.1     822   LHADYEESLSGKNMFPQPSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFIE   871
XP_532680.3        821   LHAEYEESLSGKNMFPQPSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFVE   870
NP_001230240.1     797   LHADYEESLSSKNMFPQPSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFIE   846
NP_001074633.1     817   LHAEYEESLSGKNMYPQQSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFVE   866
NP_001178629.1     816   LHAEYEESLSGKNMYPQQSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFVE   865
XP_420427.3        803   LHANYEEPLRGKNIFPQPSFGHGHFLGAVPIAPPFFPHFWYGYPVQGFIE   852
NP_001072598.1     767   TNVDFEDPATSKTIFPQPPFAQSSYMGAVPIATPYFPHFWYGYPYQGYIE   816


NP_001096123.1     808   NPVMRQNIVLPSDEKGELDLSLENLDLSKDCG----SVSTVDEFPEARGE   853
XP_003310585.1     808   NPVMRQNIVLPSDEKGELDLSLENLDLSKDCG----SVSTVDEFPEARGE   853
XP_001095354.1     872   NPVMRQNIVLPSDEKGELDLSLENLDLSKDCG----SVSTVDEFPEARGE   917
XP_532680.3        871   NPVMRQNIVLPSDEK-ELDLPLESLDLSKECV----SVSAVDEFQEARGE   915
NP_001230240.1     847   NPVMRQNIVLPSDEKGELDLPLENLDLSKECA----SVSAAEEFPEAGGE   892
NP_001074633.1     867   NPVMRQNIVLPPDDKGELDLPLENLDLSKECD----SVSAVDEFPDARVE   912
NP_001178629.1     866   NPVMRQNIVLPPDDKGELDLPLENLDLSKECD----SVSAVDEFPEARVE   911
XP_420427.3        853   NSVARPNVVMAPEDKDATSSTSANMYVAKECGAPVPAVNCVEQLQKTNSS   902
NP_001072598.1     817   SPVIRHNVYIPPQDR-DLPENLSSEAVENNSS----NQIAIRQSLDLQEQ   861


NP_001096123.1     854   HVHS---LPEASVSSKPDEGRTEQSSQTRKADTALASIPPVAEGKA---H   897
XP_003310585.1     854   HVHS---LPEASVSSKLDEGRTEQSSQTRKADTALASIPPVAEGKA---H   897
XP_001095354.1     918   HVHS---LPEASVSSKPEEGRTEQSSQTRKADMALASVPPVAEGKA---H   961
XP_532680.3        916   GTHC---LPEASVGKH--EGRAEQSSQTPKVDLARPSILPVAEEEA---H   957
NP_001230240.1     893   DPHA---PPEAGASKS--DGRAERSSQTPKAEPAAAPGPPAAEGEA---H   934
NP_001074633.1     913   GAHS---LSAASVSSK-HEGRVEQSSQTRKADIDLASGSSAVEGKG---H   955
NP_001178629.1     912   GAHS---LSEASVSSK-HEGRVEQSSQTRKADIDLSSGSSGVEGKA---H   954
XP_420427.3        903   SSSNTIPFPVAGASSE-CSAPKETSARAPQLEQTCTSASPAKQATAGLQN   951
NP_001072598.1     862   CKPD---LPLASSTGGTSSELISNASTVQSEQRMNVNIPQVLTGHK---S   905


NP_001096123.1     898   PPTQILNRERETV----------PVELEPKRTIQSLKEKTEKVKDPKTAA   937
XP_003310585.1     898   PPTQILNRERETV----------PVELEPKRTIQSLKEKTEKVKDPKSAA   937
XP_001095354.1     962   PPTQILNRERETV----------PVELEPKRTIQSLKEKTEKVKDPKTAA   1001
XP_532680.3        958   LPTQILNRERETV----------PVELEPKRTIPSLKEKSEKVKDPKTAA   997
NP_001230240.1     935   VPAQLLNREREAG----------PAGLEPKRTIPSLKEKPEKGKEPKTAA   974
NP_001074633.1     956   PPTQILNREREPG----------SAEPEPKRTIQSLKEKPEKVKDPKTAA   995
NP_001178629.1     955   PPTQILNREREAV----------SAEPEPKRTIQSLKEKPEKVKDPKTAA   994
XP_420427.3        952   RSTQIQGVERQTAVPNTTLPLAEPPKNELKNTAHSRKDKTDKVRDSKGAG   1001
NP_001072598.1     906   LPSKMKDNLVPPLA---------STPIETKETAYGSSE--DKERSEVNAV   944


NP_001096123.1     938   DVVSPGANSVDSRVQRPKEESSEDENEVSNILRSGRSKQFYNQTY-GSRK   986
XP_003310585.1     938   DVVSPGANSVDSRVQRPKEESSEDENEVSNILRSGRSKQFYNQTY-GSRK   986
XP_001095354.1    1002   DVVSPGANSVDSRVQRPKEESSEDENEVSNILRSGRSKQFYNQTY-GSRK   1050
XP_532680.3        998   DAVS-GANSVESRVQRPKEESSEDENEVSNILRSGRSKQFYNQTY-GGRK   1045
NP_001230240.1     975   DVVS-GANSVDSRVQRPKEESSEDENEVSHILRSGRSKQFYNQTF-GGRK   1022
NP_001074633.1     996   DVVSPGANSVD-RLQRPKEESSEDENEVSNILRSGRSKQFYNQTY-GSRK   1043
NP_001178629.1     995   DVLSSGANSVD-RLQRPKEESSEDENEVSNILRSGRSKQFYNQTY-GSRK   1042
XP_420427.3       1002   NLQT------ENRAQRVREESSEDENEVSDMLRSGRSKQFYNQTYGGGRR   1045
NP_001072598.1     945   ALGSTQANVSEEKALRAREESSEDEREVSNMLSSGRSKNFYSQSY-STRR   993


NP_001096123.1     987   YKSDWGY-SGRGGYQHVRSEESWKGQPSRSRDEGYQYHRNVRGRPFRGDR   1035
XP_003310585.1     987   YKSDWGY-SGRGGYQHVRSEESWKGQPSRSRDEGYQYHRNVRGRPFRGDR   1035
XP_001095354.1    1051   YKSDWGY-SGRGGYQHVRGEESWKGQPSRSRDEGYQYHRNVRGRPFRGDR   1099
XP_532680.3       1046   YKSDWGS-SGRGGYQHARGEESWKGQPGRSRDEGYQYHRNVRGRPYRGDR   1094
NP_001230240.1    1023   YKSDWGF-SGRGGYPHARGEESWKGQPSRSRDEGYQYHRNARGRPYRGDR   1071
NP_001074633.1    1044   YKSDWGS-SGRGGYQHVRGEESWKGQPNRSRDEGYQYHRHVRGRPYRGDR   1092
NP_001178629.1    1043   YKSDWGS-SGRGGYQHVRGEESWKGQPNRSRDEGYQYHRHVRGRPYRGDR   1091
XP_420427.3       1046   PRMEWGY-SSRGGYQFPRNEEAWKGPPGRSRDEGNQYQRNFRGRPYRNDR   1094
NP_001072598.1     994   PRSEKYYQPNRGGYQHPRGEEGWRGQ--RGRDDGFQHHRSYRGRPY----   1037


NP_001096123.1    1036   RRSGMGDGHRGQHT   1049
XP_003310585.1    1036   RRSGMGDGHRGQHT   1049
XP_001095354.1    1100   RRSGMGDGHRGQHT   1113
XP_532680.3       1095   RRSGMGDGHRGQNT   1108
NP_001230240.1    1072   RRSGMGDGHRGQHT   1085
NP_001074633.1    1093   RRSGMGDGHRGQHT   1106
NP_001178629.1    1092   RRSGMGDGHRGQHT   1105
XP_420427.3       1095   RRATLGDNQRGHQA   1108
NP_001072598.1    1038   RRRPMGDSYRAQQE   1051


Protein Acc. Gene Organism
NP_001096123.1 OTUD4 H.sapiens
XP_003310585.1 OTUD4 P.troglodytes
XP_001095354.1 OTUD4 M.mulatta
XP_532680.3 OTUD4 C.lupus
NP_001230240.1 OTUD4 B.taurus
NP_001074633.1 Otud4 M.musculus
NP_001178629.1 Otud4 R.norvegicus
XP_420427.3 OTUD4 G.gallus
NP_001072598.1 otud4 X.tropicalis


Support Center