Display Settings:

Format

Send to:

Choose Destination
HomoloGene:3444. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_004682.2          1   MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQ   50
XP_001163837.1       1   MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQ   50
XP_536816.2          1   MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQ   50
NP_776930.1          1   MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQ   50
NP_038505.2          1   MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQ   50
NP_001011927.1       1   MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQ   50
XP_414041.1          1   MSCFPELYFNVDNGYLEGLVRGFKAGVLRQGDYVNLVQCESLEDLKLHLQ   50
NP_955914.1          1   -MPFSELYFNVDNGYLEGLVRGFKAGILSQADYLNLVQCETLEDLKLHLQ   49
NP_570080.1          1   -MNSSGFMFNIDNGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQ   49
XP_311260.4          1   ---MPGYMFNIDGGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQ   47
NP_491515.2          1   ---MGEFLFNIDHGYLEALTRGLKGGLLAQADYANLVQCETLEDLKLHIQ   47
NP_013552.3          1   ---MEGVYFNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLS   47
XP_451745.1          1   ---MEGVFFNVDNGFIEGIVRGYRNGLLNGSQYINLTQCDTLEDLRLQLA   47
NP_985005.2          1   ---MEGVFFNVDNGYIEGVVRGYRNGLLTSSQYLNLTQCDTLDDLKLQLS   47
NP_594237.1          1   ---MDALSFNTNSGYIEALVRGYESALLEQHIYSNLSQCESLEDFRLQLS   47
XP_003709765.1       1   ---MEGLLFNVNNGYIEGIVRGYRNGLLTGSNYANMTQCESVDDLKLQLG   47
XP_956842.1          1   ---MEGLLFNVNNGYIEGIVRGYRNSLLTSTNYTNMTQCESIDDLKLQLG   47
NP_189512.1          1   MYGFEALTFNIHGGYLEAIVRGHRAGLLTTADYNNLCQCENLDDIKMHLS   50
NP_189513.1          1   MYGFEALTFNIHGGYLEAIVRGHRAGLLTTADYNNLCQCENLDDIKMHLS   50
NP_001043429.1       1   MYGWEMLSFNIHDGFLEAIVRGNRSGLLTAADYNNLCQCENLDDVKMHLT   50
NP_001017310.1       1   MTSFSELYFNVDSGYLEGLVRGFKAGILSQGDYLNLVQCETLEDLKLHLQ   50


NP_004682.2         51   STDYGNFLANEASP-LTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDF   99
XP_001163837.1      51   STDYGNFLANEASP-LTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDF   99
XP_536816.2         51   STDYGNFLANEASP-LTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDF   99
NP_776930.1         51   STDYGNFLANEASP-LTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDF   99
NP_038505.2         51   STDYGNFLANEASP-LTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDF   99
NP_001011927.1      51   STDYGNFLANEASP-LTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDF   99
XP_414041.1         51   STDYGNFLANEASP-LTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDF   99
NP_955914.1         50   STDYGSFLANEASP-LTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDF   98
NP_570080.1         50   GTDYGSFLANEPSP-LSVSVIDDKLREKLVIEFQHMRNHAVEPLSNFLDF   98
XP_311260.4         48   GTDYGQFLANEPSP-LAVSVIDDKLREKLVIEFQHMRNHAVEPLSTFLDY   96
NP_491515.2         48   STDYGNFLANEPGA-ITVQVIDEKLKEKLVTEFTHLRNNALEPLATFLDY   96
NP_013552.3         48   STDYGNFLSSVSSESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDY   97
XP_451745.1         48   STDYGNFLSNVSSDSLTTTVIQERAADRLYQEFQYVRDQSSGATKKFMDF   97
NP_985005.2         48   STDYGGFLSNVASEALTTSVIQERASHKLYQQFQYIRDQSSGTTRRFMDY   97
NP_594237.1         48   STDYGGFLAN-QSK-LTSSIISAKATEKLLDEFDLIRRQADETLSKFMDY   95
XP_003709765.1      48   PS-YGDFLASLPPN-PSTSALAAKATDKLVSEFRYVRANAVGSLAQFMDY   95
XP_956842.1         48   PA-YGDFLASLPPK-PSTSALAAKTTDKLVSEFRYVRANAAGSLAKFMDY   95
NP_189512.1         51   ATKYGSYLQNEPSP-LHTTTIVEKCTLKLVDDYKHMLCQATEPMSTFLEY   99
NP_189513.1         51   ATKYGPYLQNEPSP-LHTTTIVEKCTLKLVDDYKHMLCQATEPMSTFLEY   99
NP_001043429.1      51   ATEYGPYLQNEPSP-LHTTTIVEKCTLKLVDEYKHMMCQATEPLSTFLQY   99
NP_001017310.1      51   STDYGTFLANEASP-LAVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDF   99


NP_004682.2        100   ITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAE   149
XP_001163837.1     100   ITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAE   149
XP_536816.2        100   ITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAE   149
NP_776930.1        100   ITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAE   149
NP_038505.2        100   ITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAE   149
NP_001011927.1     100   ITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAE   149
XP_414041.1        100   ITYSYMIDNVILLITGTLHQRSISELVPKCHPLGSFEQMEAVNIAQTPAE   149
NP_955914.1         99   ITYSYMIDNVILLITGTLHQRAISELVPKCHPLGSFEQMEAVNIAQTPAE   148
NP_570080.1         99   ITYGYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVASTPAE   148
XP_311260.4         97   ITYSYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVAATPAE   146
NP_491515.2         97   ITYSYMIDNIILLITGTLHQRPISELINKCHPLGSFEQMEAIHIASTPAE   146
NP_013552.3         98   ITYGYMIDNVALMITGTIHDRDKGEILQRCHPLGWFDTLPTLSVATDLES   147
XP_451745.1         98   ITYGYMIDNVALMITGTIHDRDKAEILGRCHPLGWFETLPTLTVATDLES   147
NP_985005.2         98   ITYGYMIDNVALMITGTVHERDKAEILPRCHPLGWFDTLPTLTVATDLES   147
NP_594237.1         96   ITYAYMIDNIMLLLTGTVNGQDTHDLLERCHPLGWFETLPALCVATNVEE   145
XP_003709765.1      96   LTYGYMIDNVALLITGTLHERDTRELLERCHPLGWFETMPVLCVATNIEE   145
XP_956842.1         96   LTYGYMIDNVALLITGTLHERDTRELLERCHPLGWFETMPVLCVATNIEE   145
NP_189512.1        100   IRYGHMIDNVVLIVTGTLHERDVQELIEKCHPLGMFDSIATLAVAQNMRE   149
NP_189513.1        100   IRYGHMIDNVVLIVTGTLHERDVQELIEKCHPLGMFDSIATLAVAQNMRE   149
NP_001043429.1     100   ITYGHMIDNVVLIVTGTLHERDVNELLEKCHPLGMFDSIASLAVAQNMRE   149
NP_001017310.1     100   ITYSYMIDNVILLITGTLHQRSISELVPKCHPLGSFEQMEAVNIAQTPAE   149


NP_004682.2        150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLESFYKFCT   198
XP_001163837.1     150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKVMPHTSHXFLP   198
XP_536816.2        150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLESFYKFCT   198
NP_776930.1        150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLESFYKFCT   198
NP_038505.2        150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLESFYKFCT   198
NP_001011927.1     150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLESFYKFCT   198
XP_414041.1        150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLESFYKFCK   198
NP_955914.1        149   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLEAFYKFCT   197
NP_570080.1        149   LYNAVLVDTPLAPFFVDCI-SEQDLDEMNIEIIRNTLYKAYLEAFYNFCK   197
XP_311260.4        147   LYNAVLVDTPLAPFFVDCI-SEQDLDEMNIEIIRNTLYKAYLEAFYDFCK   195
NP_491515.2        147   LYNAVLVDTPLANYFVDCI-NEQDLDEMNVEVIRNTLYKAYIEDFYKFCA   195
NP_013552.3        148   LYETVLVDTPLAPYFKNCFDTAEELDDMNIEIIRNKLYKAYLEDFYNFVT   197
XP_451745.1        148   LYETVLVDTPLASYFRDCFDDADELDDLNIEIIRNKLYRAYLQDFYDFIS   197
NP_985005.2        148   LYQTVLVDTPLAPYFRDCFDGADELDDLNIEIIRNKLYRAYLHDFHEFVS   197
NP_594237.1        146   LYSVVLIETPLAPYFKDCL-SADDLDEQHIEIIRNTLYKAYLEDFYNFCK   194
XP_003709765.1     146   LYNSVLIETPLAPYFKNSL-SHTDLDELNIEIVRNTLYKNYLEDFHNFVN   194
XP_956842.1        146   LYNSVMIETPLAPYFKSSL-SLQDLDELNIEIVRNTLYKNYLEDFYHFVN   194
NP_189512.1        150   LYRLVLVDTPLAPYFSECL-TSEDLDDMNIEIMRNTLYKAYLEDFYKFCQ   198
NP_189513.1        150   LYRLVLVDTPLAPYFSECL-TSEDLDDMNIEIMRNTLYKAYLEDFYNFCQ   198
NP_001043429.1     150   LYRLVLVDTPLAPYFSECI-TSEDLDDMNIEIMRNTLYKAYLEDFYKFCE   198
NP_001017310.1     150   LYNAILVDTPLAAFFQDCI-SEQDLDEMNIEIIRNTLYKAYLESFYKFCD   198


NP_004682.2        199   L----LGGTTADAMCPILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   242
XP_001163837.1     199   L----LGGTTADAMCLILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   242
XP_536816.2        199   L----LGGTTADAMCPILEFEADRRAFIITINSFDTE--LSKEDRAKLFP   242
NP_776930.1        199   L----LGGTTADAMCPILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   242
NP_038505.2        199   L----LGGTTADAMCPILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   242
NP_001011927.1     199   L----LGGTTADAMCPILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   242
XP_414041.1        199   A----LGGTTADAMCPILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   242
NP_955914.1        198   T----LGGTTADTMCPILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   241
NP_570080.1        198   N----MGGATADVMCEILAFEADRRAIIITINSFGTE--LSKDDRAKLYP   241
XP_311260.4        196   N----IGGTTADVMCEILAFEADRRAIIITINSFGTE--LSKDDRAKLYP   239
NP_491515.2        196   G----LGGKTAEVMCDILAFEADRRSIIITINSFDTE--LSKDDRQKLYP   239
NP_013552.3        198   EE---IPEPAKECMQTLLGFEADRRSINIALNSLQSSD-IDPDLKSDLLP   243
XP_451745.1        198   TE---VDEPAREIMKELLEFEADRRAINISLNSLQSSDVITSDLKRDLLP   244
NP_985005.2        198   SE---VPEPAREVMQSLLEFEADRRAINIALNSLQSSDVITSELKRELLP   244
NP_594237.1        195   K----IGACTADTMLPILEFEADRRAITITINSFGTE--LSKEERAKMYP   238
XP_003709765.1     195   THPDMAGTPTAEVMSEILEFEADRRAINITLNSFGTE--LTKEDRKKLYP   242
XP_956842.1        195   THPDMAGTPTAEVMSELLEFEADRRAINITLNSFGTE--LSKADRKKLYP   242
NP_189512.1        199   K----LGGATAEIMSDLLAFEADRRAVNITINSIGTE--LTREDRKKLYS   242
NP_189513.1        199   K----LGGATAEIMSDLLAFEADRRAVNITINSIGTE--LTREDRKKLYS   242
NP_001043429.1     199   K----LGGATAEIMCDLLSFEADRRAVNITINSIGTE--LTRDDRRKLYS   242
NP_001017310.1     199   S----LGGTTADAMCPILEFEADRRAFIITINSFGTE--LSKEDRAKLFP   242


NP_004682.2        243   HCGRLYPEGLAQLA-RADDYEQVKNVADYYPEYKLLFEGAGSNPGD----   287
XP_001163837.1     243   HCGRLYPEGLAQLA-RADDYEQVKNVADYYPEYKLLFEGAGSNPGD----   287
XP_536816.2        243   HCGRLYPEGLAQLA-RADDYEQVKNVADYYPEYKLLFEGAGSNPGD----   287
NP_776930.1        243   HCGRLYPEGLAQLA-RADDYEQVKNVADYYPEYKLLFEGAGSNPGD----   287
NP_038505.2        243   HCGRLYPEGLAQLA-RADDYEQVKNVADYYPEYKLLFEGAGSNPGD----   287
NP_001011927.1     243   HCGRLYPEGLAQLA-RADDYEQVKNVADYYPEYKLLFEGAGSNPGD----   287
XP_414041.1        243   HCGKLYPEGLAQLA-RADDYEQVKNVADYYPEYKLLFEGAGSNPGD----   287
NP_955914.1        242   HCGKLYPEGLAQLA-RADDYEQVKAVAEYYPEYKLLFEGAGSNPGD----   286
NP_570080.1        242   NCGKMYPDGLAALA-RADDYEQVKTVAEYYAEYAALFDGSGNNPGD----   286
XP_311260.4        240   RCGRMNPDGLAALA-RADDYEQVKAVAEYYAEYAALFDGSGNNPGD----   284
NP_491515.2        240   RCGKLFPDGLTGLS-RADDYDQVKQVCEFYSDYKPLFEGSGNGPGE----   284
NP_013552.3        244   NIGKLYPLATFHLA-QAQDFEGVRAALANVYEYRGFLET-----------   281
XP_451745.1        245   KLGKLYPVATEQLAIHGQDFESVRQIVDTVYPYRGIFET-----------   283
NP_985005.2        245   NMGKLYPTITEQLATQAMDFEGLRTVLSNVHEYRGIFDT-----------   283
NP_594237.1        239   SFGRLYPFSTSILA-RAENAGDVENACSLVKEYSDFFDQ-----------   276
XP_003709765.1     243   TFGRLYPEGTLMLS-RADDLDGVRLAVDGVSDYKSFFDTAGLSGGLSGPG   291
XP_956842.1        243   NFGQLYPEGTLMLS-RADDFEGVRLAVEGVADYKSFFDAAGLGGGPSGPG   291
NP_189512.1        243   NFGLLYPYGHEELA-ICEDIDQVRGVMEKYPPYQAIFSKMSYGES-----   286
NP_189513.1        243   NFGLLYPYGHEELA-ICEDIDQVRGVMEKYPPYQAIFSKMSYGES-----   286
NP_001043429.1     243   NFGLLYPYGHEELA-VCEDVDQVRGVMEKYPPYQAIFAKISYGES-----   286
NP_001017310.1     243   HCGKLYPEGLAQLA-RADDYEQVKTVADYYPEYKLLFEGAGNNPGD----   287


NP_004682.2        288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQEC   326
XP_001163837.1     288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQEC   326
XP_536816.2        288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGIFYAFVKLKEQEC   326
NP_776930.1        288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQEC   326
NP_038505.2        288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQEC   326
NP_001011927.1     288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQEC   326
XP_414041.1        288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQEC   326
NP_955914.1        287   -----------KTLEDRFFEHEVKLNKLAFLNQFHFSVFYAYVKLKEQEC   325
NP_570080.1        287   -----------KTLEDKFFEHEVKLDVYAFLQQFHFGVFYAYLKLKEQEC   325
XP_311260.4        285   -----------KTLEDKFYEHEVKLNMYGFMQQFHFGVFYSYLKLKEQEC   323
NP_491515.2        285   -----------KTLEDKFFEHEVKLNVHSYLHQFHFGVFYAFIKLKEQEM   323
NP_013552.3        282   -----------GNLEDHFYQLEMELCRDAFTQQFAISTVWAWMKSKEQEV   320
XP_451745.1        284   -----------GNLEDHFYKLEMELCRDAFTQQFTVSTIWAWMKSREQEV   322
NP_985005.2        284   -----------GNIEDQFYKIEMELCRDAFTQQFTVSTIWAWMKSREQEV   322
NP_594237.1        277   --------NSQKSLDDHFNEKEVELNKLAFLQQFHYGIVYAFLKLREQEI   318
XP_003709765.1     292   NMGGGQGGSEGKSLEDMFYQKEMEISKSAFTRQFTFAIVYAWVKLREQEI   341
XP_956842.1        292   NMGG--GGTEGKSLEDMFYQKEMEISKMAFTRQFTYAIVYAWVKLREQEI   339
NP_189512.1        287   -----------QMLDKAFYEEEVRRLCLAFEQQFHYAVFFAYMRLREQEI   325
NP_189513.1        287   -----------QMLDKAFYEEEVRRLCLAFEQQFHYAVFFAYMRLREQEI   325
NP_001043429.1     287   -----------QMLDKAFYEEEVRRLCLSFEQQFHYAVFFAYIRLREQEI   325
NP_001017310.1     288   -----------KTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQEC   326


NP_004682.2        327   RNIVWIAECIAQRHRAKI-DNYIPIF   351
XP_001163837.1     327   RNIVWIAECIAQRHRAKI-DNYIPIF   351
XP_536816.2        327   RNIVWIAECIAQRHRAKI-DNYIPIF   351
NP_776930.1        327   RNIVWIAECIAQRHRAKI-DNYIPIF   351
NP_038505.2        327   RNIVWIAECIAQRHRAKI-DNYIPIF   351
NP_001011927.1     327   RNIVWIAECIAQRHRAKI-DNYIPIF   351
XP_414041.1        327   RNIVWIAECIAQRHRTKI-DNYIPIF   351
NP_955914.1        326   RNIVWIAECIAQRHRAKI-DNYIPIF   350
NP_570080.1        326   RNIVWIAECVAQKHRAKI-DNYIPIF   350
XP_311260.4        324   RNIVWIAECVAQKHRAKI-DNYIPIF   348
NP_491515.2        324   RNIIWIAECISQRHRTKI-DNYIPIM   348
NP_013552.3        321   RNITWIAECIAQNQRERI-NNYISVY   345
XP_451745.1        323   RNITWIAECIAQNQKSKI-NNYISVY   347
NP_985005.2        323   RNITWIAECIAQNQRERI-NNYISIY   347
NP_594237.1        319   RNLTWIAECISQNQRDRA-LNIVPIL   343
XP_003709765.1     342   RNITWIAECIAQNQKERI-GNYISVF   366
XP_956842.1        340   RNITWIAECIAQNQKERI-NNYISVF   364
NP_189512.1        326   RNLMWISECVAQNQKSRIHDSVVYMF   351
NP_189513.1        326   RNLMWISECVAQNQKSRIHDSVVYMF   351
NP_001043429.1     326   RNLMWISECVAQNQKNRVHDSVVFIF   351
NP_001017310.1     327   RNIVWIAECIAQRHRAKI-DNYIPIF   351


Protein Acc. Gene Organism
NP_004682.2 ATP6V0D1 H.sapiens
XP_001163837.1 ATP6V0D1 P.troglodytes
XP_536816.2 ATP6V0D1 C.lupus
NP_776930.1 ATP6V0D1 B.taurus
NP_038505.2 Atp6v0d1 M.musculus
NP_001011927.1 Atp6v0d1 R.norvegicus
XP_414041.1 ATP6V0D1 G.gallus
NP_955914.1 atp6v0d1 D.rerio
NP_570080.1 VhaAC39-1 D.melanogaster
XP_311260.4 AgaP_AGAP000721 A.gambiae
NP_491515.2 vha-16 C.elegans
NP_013552.3 VMA6 S.cerevisiae
XP_451745.1 KLLA0B04752g K.lactis
NP_985005.2 AGOS_AER146C E.gossypii
NP_594237.1 vma6 S.pombe
XP_003709765.1 MGG_07007 M.oryzae
XP_956842.1 NCU03395 N.crassa
NP_189512.1 AT3G28710 A.thaliana
NP_189513.1 AT3G28715 A.thaliana
NP_001043429.1 Os01g0587000 O.sativa
NP_001017310.1 atp6v0d1 X.tropicalis


Support Center