Display Settings:

Format

Send to:

Choose Destination
HomoloGene:32442. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_859062.1          1   ---MTLRRLRKLQQKEEAA---ATPDPAARTPDSEVAPAAPVPTP--GPP   42
XP_001141173.2       1   ---MTLRRLRKLQQKEEAA---ATPDPAARTPDSEVAPAAPVPTP--GPP   42
XP_001085174.2       1   ---MTL-----------------------------------LPSR--G--   8
NP_001179070.1       1   ---MTLRRLRKLQQKEEAA---AAPDPSARAPDSEAAPAAPTPTPASGPP   44
NP_062391.3          1   ---MTLRRLRKLQQKEEAT---AAPDPAGRAPDSEAARAAPLPS---GPP   41
NP_620249.1          1   ---MTLRRLRKLQQKEEAT---AAPDLAGRAPDSEAARAAPTPS---GPP   41
NP_001035013.1       1   MKNMTFRRVKKLNSSDPDSGSLCHDSGDIYFTSSKSDSCGIVNR---GP-   46
NP_001120354.1       1   ---MTFRRLRKLQHKEEYA---CPPDRTVYRDRDKLDP------------   32


NP_859062.1         43   AAAATPGPPADELYAALEDYHPAELYRALAVSGGTLPR---RKGSGFRWK   89
XP_001141173.2      43   AAAATPGPPADELYAALEDYHPAELYRALAVSGGTLPR---RKGSGFRWK   89
XP_001085174.2           --------------------------------------------------
NP_001179070.1      45   AAAAGPGTPGDELYAALEDYHPAELYRALAVSGGTLPR---RKGSGFRWK   91
NP_062391.3         42   AAAAPPGAPGEELYAALEDYHPAELYRALAVSGGTLPR---RKGSGFRWK   88
NP_620249.1         42   AAAAPPGAPGDELYAALEDYHPAELYRALAVSGGTLPR---RKGSGFRWK   88
NP_001035013.1      47   -------------SNSTEVYN----YKTLAYSGGTLPRNFKKNGGLQKWK   79
NP_001120354.1      33   -------------YSALTSYKQADMYKALAVSGGTLPRT--KKGSTAGWK   67


NP_859062.1         90   NLSQSPEQQRKVLTLEKEDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVH   139
XP_001141173.2      90   NLSQSPEQQRKVLTLEKEDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVH   139
XP_001085174.2           --------------------------------------------------
NP_001179070.1      92   NLSQSPEQQRKVLTLEKEENQTFGFEIQTYGLHHREEQRVEMVTFVCRVH   141
NP_062391.3         89   NFTQSPEQQRKVLTLEKGDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVH   138
NP_620249.1         89   NFTQSPEQQRKVLTLEKGDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVH   138
NP_001035013.1      80   PLAQSPEPQRKTVILEKKEEESFGFEIQTYGLHHQSENSVEMCTFVCKVH   129
NP_001120354.1      68   NVSQSSEYQRKILTLQKEDSESFGFEIQTYGLHHQDKNAVEMFTFVCRVQ   117


NP_859062.1        140   ESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYG   189
XP_001141173.2     140   ESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYG   189
XP_001085174.2       9   ------------GDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYG   46
NP_001179070.1     142   ESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYG   191
NP_062391.3        139   ESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYG   188
NP_620249.1        139   ESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYG   188
NP_001035013.1     130   EDSPALLAGLKVGDTIASVNDTSVDGFRHKEIVQLIKSSGNNIRLETVYS   179
NP_001120354.1     118   DGSPAQLCGLKVGDIIAGVNGLNMDGVRHRDIVELIKVSGNTIRLETVYG   167


NP_859062.1        190   TSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDT   239
XP_001141173.2     190   TSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDT   239
XP_001085174.2      47   TSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDT   96
NP_001179070.1     192   TSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDT   241
NP_062391.3        189   TSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDT   238
NP_620249.1        189   TSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYDT   238
NP_001035013.1     180   DSIRKAELEARLQYLKQTLHEKWDEYRSLMVQEQRLVHGIVMSDVAMYES   229
NP_001120354.1     168   SAIRRAELEARIQYLKQTLYEKWEEYRSLMVQEQRLLHGIVVKDPSVYDT   217


NP_859062.1        240   LESVRSCLYGAGLLPGSLPF-GPLLAVPGRPRGGARRARGDADDAVYHTC   288
XP_001141173.2     240   LESVRSCLYGAGLLPGSLPF-GPLLAVPGRPRGGAR--------------   274
XP_001085174.2      97   LESVRSCLYGAGLLPGSLPF-GPLLAVPGRPRGGARRARGDADDAVYHTC   145
NP_001179070.1     242   LESVRSCLYGAGLLPGSLPF-GPLLAAPGGSRGGARRTGGDSDDAVYHTC   290
NP_062391.3        239   LESVRSCLYGAGLLPGSLPF-GPLLAAPGSARGGARRAKGDTDDAVYHTC   287
NP_620249.1        239   LESVRSCLYGAGLLPGSLPF-GPLLAAPGGARGGSRRAKGDTDDAVYHTC   287
NP_001035013.1     230   LES--AGVYGSLGAPSPAALRALRGTDSTSSSVSHLSAATAEDDPLYQTC   277
NP_001120354.1     218   LESVRSYIYGTVNTCSKDPLTGTLAAGSMCSSASCLSTTEENEDAVYQTC   267


NP_859062.1        289   FFGDSEPPALPPPPPPARAFGPGPAETPAVGPGPGPRAALSRSASVRC--   336
XP_001141173.2           --------------------------------------------------
XP_001085174.2     146   FFGDSEPPALPPPPPPVRVLGPGPAETPAVGPGPGPRAALSRSASVRC--   193
NP_001179070.1     291   FFGGAEPPAPPPPPPPPLARLPGPGAADA--SAPGSRAMLSRSASVRC--   336
NP_062391.3        288   FFGGAEPQALPPPPPPARALGPSSAETPASVLFPAPRSTLSRSASVRC--   335
NP_620249.1        288   FFGGAEPQALPPPPPPARAPGPGSAETPASVLCPAPRATLSRSASVRC--   335
NP_001035013.1     278   IFNNTSNDQIHA----KQENTRPRLIRPASELFTTAKTSLTRSASTRSYL   323
NP_001120354.1     268   YFSSDSTDEINSLPGKSNNNGKPY------------KSTLTRSSSVKC--   303


NP_859062.1        337   AGPGGGGGGGAPGALWTEAREQALCGPGLRKTKYRSFRRRLLKFIPGLNR   386
XP_001141173.2     275   ---------------------------------YRSFRRRLLKFIPGVNR   291
XP_001085174.2     194   AGPGGGGGGGAPGALWTEAREQALCGPGLRKTKYRSFRRRLLKFIPGLNR   243
NP_001179070.1     337   AGP-GGGGGGAPSALWTEAREQALCGPGLRKTKYRSFRRRLLKFIPGLNR   385
NP_062391.3        336   AGP--GGGGGAPGALWTEAREQALCGAGLRKTKYRSFRRRLLKFIPGLNR   383
NP_620249.1        336   AGPGGGGGGGAPGALWTEAREQALCGAGLRKTKYRSFRRRLLKFIPGLNR   385
NP_001035013.1     324   RPPSSSSSASSSAVPNGEKQQCGGFSSLQRKPKQKSFRRRLLKYIPGLNR   373
NP_001120354.1     304   PGP---------ATNWDKPKEQNNF-VSLPRKKHKSFRKRLLKFIPGLNR   343


NP_859062.1        387   SLEEEESQL   395
XP_001141173.2     292   SLEEEESQL   300
XP_001085174.2     244   SLEEEESQL   252
NP_001179070.1     386   SLEEEESQL   394
NP_062391.3        384   SLEEEESQL   392
NP_620249.1        386   SLEEEESQL   394
NP_001035013.1     374   PLEEEESKL   382
NP_001120354.1     344   NLEEEASPL   352


Protein Acc. Gene Organism
NP_859062.1 GRASP H.sapiens
XP_001141173.2 GRASP P.troglodytes
XP_001085174.2 GRASP M.mulatta
NP_001179070.1 GRASP B.taurus
NP_062391.3 Grasp M.musculus
NP_620249.1 Grasp R.norvegicus
NP_001035013.1 grasp D.rerio
NP_001120354.1 grasp X.tropicalis


Support Center