Display Settings:

Format

Send to:

Choose Destination
HomoloGene:32395. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_060643.2          1   MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVLDPSR   50
XP_522333.2          1   MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGHPVLDPSR   50
XP_001118229.2       1   MKAFGPPNEGPLQGLVASRIETYGGRHRASAQSTAGSLYPRGGLLLDPSR   50
XP_534913.2          1   MQTFAPSDESPFRGLVASRIETYGGRHQASNQSFPGGPYFRGGPGLDPSG   50
XP_003586191.1       1   MQALGPPDKSPLQGLVASRIETYGGRYRASVSSPPGNVYPQGGLLLDPSR   50
NP_941006.2          1   MQAFGPPNEGPLQGLVASRIETYGGRHQTSAHSTAGNLFPRGGPGVDPSR   50
XP_006237465.1       1   MQTFDPPNEGPLQGLVASRIETYGGRHQTSAQSSAGITYPRGGPALDLSR   50


NP_060643.2         51   RRLQQYVPFARGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKEL   100
XP_522333.2         51   RRLQQYVPFARGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKEL   100
XP_001118229.2      51   RRLQQYVPFVRGSGQSRGLSPMRLRDPEPEKRHGGHVGAGLPHSPKLKEV   100
XP_534913.2         51   RRLQGYVPFAKGSGHVRSVSPLKLREPEPEKKHGGHFGAGPPHSPKVKEV   100
XP_003586191.1      51   RRFMGYVPFTTGSGPARRLSPLRLREPEPEKTHGSPFGVGTPHSPKLKEV   100
NP_941006.2         51   RRLQHYVPFAKGSGQTRGMSPLVLREPDPEKRHGSYFGVGPPHSPKLKEV   100
XP_006237465.1      51   RRLQHYVPFAKGSGQTRGLSP---QEPDPEKRHGNYFGVGSPYFPKFKEV   97


NP_060643.2        101   TKAHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLTIEKSWRELVP   150
XP_522333.2        101   TKAHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLTIEKSWRELVP   150
XP_001118229.2     101   TKAHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLAIEKSWRELVP   150
XP_534913.2        101   TNAHQLEMRLHTFSMFGMPRLPPEDRRYWEIGEGSDNGLVIEKSWKELVP   150
XP_003586191.1     101   TKAHELQVRLHTFSMFGMPRLPREDRQHWEIGEGNDNSVAIEKSWKELVP   150
NP_941006.2        101   TRAHELEIRLHTFSMFGMPRLPPEDRRHWEIGEGGDSALTMEKSWKELVL   150
XP_006237465.1      98   SKAHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSALTIEKSWKELVL   147


NP_060643.2        151   GHKEMSQELCHQQEALWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLL   200
XP_522333.2        151   GHKEMSRELCHQQEALWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLL   200
XP_001118229.2     151   GHKEMSRELCHQQEALWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLL   200
XP_534913.2        151   GHKEMSRELCHQQEAIWELLTTELTYVRKLKIMTDLLVSGLLNLQRVELL   200
XP_003586191.1     151   GHKEMSRDLCHQQEALWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLL   200
NP_941006.2        151   EHKEMNRQLCHQQEALWELLTTELIYLRKLKIMTDLLAAGLLNLQRVGLL   200
XP_006237465.1     148   GHKEMNRELCHQQEALWELLTTELIYLRKLKIMTDLLAAGLLNLQRVGLL   197


NP_060643.2        201   MEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGF   250
XP_522333.2        201   MEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGF   250
XP_001118229.2     201   TEVSAETLFGNVPSLIRTHRSFWEEVLGPTLEETPASGQPLDPMGLESGF   250
XP_534913.2        201   TEVSAETLFGNIPSLIRVHKSFWEEVLGPTLEETRTSGRPLDPVSLQNGF   250
XP_003586191.1     201   TEVSAETLFGNVPNLIRAHRSFWEEVLGPTLEDTRASGQPLDPVSLQDGF   250
NP_941006.2        201   TEVSAETLFGNVPNLIRAHRRFWEEVLQPILEDTRTSGQPLDPVSLQNGF   250
XP_006237465.1     198   TEVSAETLFGNVPKLIRTHRRFWEEVLQPILEDTRTSGQPLDPVSLQNGF   247


NP_060643.2        251   LTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ   300
XP_522333.2        251   LTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ   300
XP_001118229.2     251   LTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ   300
XP_534913.2        251   LTFSQRFQPYVQYCLQVKRTMAYAREQQDNNPLFHAFVQWCEKHKRSGRQ   300
XP_003586191.1     251   LTCSQRFQPYVLYCLRVRQTMAYAREQQDHNPLFHIFVQWCEKHKLSGRQ   300
NP_941006.2        251   LTFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQ   300
XP_006237465.1     248   LTFGQRFQPYIQYCLRVKQTMAYAREQQDTNPLFRTFVQWCEKHKRSGRQ   297


NP_060643.2        301   MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHI   350
XP_522333.2        301   MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHI   350
XP_001118229.2     301   MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHI   350
XP_534913.2        301   MLGDLLIKPHQRITKYPLLLQAVLKRSPEAHAREALNTMIAAVESFLRHI   350
XP_003586191.1     301   MLGDLLIKPHQRITKYPLLLQAVLKRTPKPQAREALTAMIAAMESFLQHI   350
NP_941006.2        301   TLGDLLIKPHQRITKYPLLLQAVRKRSPEPRAQEALNAMIEAVESFLRHI   350
XP_006237465.1     298   TLGDLLIKPHQRITKYPLLLQAVLKRSPEPRAQLALDNMIVAVESFLQHI   347


NP_060643.2        351   NGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPML   400
XP_522333.2        351   NGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPML   400
XP_001118229.2     351   NGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPML   400
XP_534913.2        351   NQQVRQGEEQESLVAAAQRIGPYEVLEPSSEEVEKNLRPFCTLDLMSPML   400
XP_003586191.1     351   NKQVRQGEEQESLVAAARRIGPYEVLEPSSEEVEKNLRPFSTLDLMAPML   400
NP_941006.2        351   NGQVRQGEEQESLMAVAQRIGPYEVLEPSSEEVEKNLRPFSTLDLMTPVL   400
XP_006237465.1     348   NGLVRRGEEQESLMAVAQRIGPYEVLEPSSEEVEKHLRQFSTLDLMTPIE   397


NP_060643.2        401   GVASEHTRQLLLEGPVRVKEGREGK-LDVYLFLFSDVLLVTKPQRKADKA   449
XP_522333.2        401   GVASEHTRQLLLEGPVRVKEGREGK-LDVYLFLFSDVLLVTKPQRKADKA   449
XP_001118229.2     401   GVASEHTRQLLLEGPVRVKEGREGK-LDVHLFLFSDVLLVTKPQSKVDKA   449
XP_534913.2        401   GVASEHIRQLLLEGPVRVKEGREGK-LDVYLFLFSDVLLVTKPQRKADRA   449
XP_003586191.1     401   GVAPEHTRQLLFEGPARVKEGREGKILCVYLCVLSSFLSPFPSATEAEVG   450
NP_941006.2        401   GVAPEYTRQLLLEGPVRVKEGREGK-MDVYLFLFSDVLLVTKPQRKADRA   449
XP_006237465.1     398   GVAPENTRQLLLEGPVRMKEGREGK-MDVYLFLFSDVLLVTKPQRKVDKA   446


NP_060643.2        450   KVIRPPLMLEKLVCQPLR----DPNSFLLIHLTEFQCVSSALLVHCPSPT   495
XP_522333.2        450   KVIRPPLMLEKLVCQPLR----DPNSFLLIHLTEFQCVSSALLVHCPSPT   495
XP_001118229.2     450   KVIRPPLMLEKLVCQIMGVGEVDETQTAAISLPAQKTSIFNNDMAIPASA   499
XP_534913.2        450   KVIRPPLMLEKLVCQPLR----DPNSFLVIHLTDFQCVSSAFIVHCPSAT   495
XP_003586191.1     451   LGIRXGPALEADLFLP-------PGSFLLIHLTEFQCVSSALTVHCPSTA   493
NP_941006.2        450   KVIRPPLMLEKLVCRPLR----DPNSFLLIHLTEFQCVSSALTVHCPSST   495
XP_006237465.1     447   KVIRPPLMLEKLVCRPLR----DPHSFLLIHLTEFQCVSSALTVHCSSST   492


NP_060643.2        496   D-RAQWLEKTQQAQAALQKLKAEEYVQQKRELLTLY-R----DQDRESPS   539
XP_522333.2        496   D-RAQWLEKTQQAQAALQKLKAEEYVQQKRELLTLY-R----DQDRESPS   539
XP_001118229.2     500   DISAAHCSHRGVLRAAGSRMKVGVDLQNIRAAKSPSVR----GPSRIAPL   545
XP_534913.2        496   D-CAQWLKKTQQAQATLQKLKAEEYVQQKRELLALY-RDQDQDQDQESSG   543
XP_003586191.1     494   N-RARWLEKTQQAQATLQKLKAEEYIQQKRELLALY-R----DRDGESPC   537
NP_941006.2        496   E-RARWLEKTQHAQTTLQKLKGEQYIQQKRELLALY-R----NQGTESPS   539
XP_006237465.1     493   E-RTQWLQKTQQAQATLQKLKAEEYVQQKRGLLALY-R----DQGRESPS   536


NP_060643.2        540   TRPST------PSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPLVPD   583
XP_522333.2        540   TRPST------PSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPLVPD   583
XP_001118229.2     546   LGSSL------KRKEESIIEDNIKTPEFSTIIPHLVVTEDTDEDAPFVPD   589
XP_534913.2        544   TRPSSPSPPSPPSPEGSQSSAEGRTPEFSTIIPQLVVTEDTDEDSPSVPD   593
XP_003586191.1     538   TRPST------PSQEGSQNSTEGRTCESSTVIPHLVVTEDTDDDAPSVPD   581
NP_941006.2        540   TRPSTPS----PSPEDSQSSAEGRTLEF-AIIPRLVVTEDTDEDTPSMPD   584
XP_006237465.1     537   PRPST------PSPEDSQSSAEGRALEF-TVIPRLVVTEDTDEDTPSVTD   579


NP_060643.2        584   DTSDSGYGTLIPGTPTGSRSPLSRLRQRALRRDPRLTFSTLELRDIPLRP   633
XP_522333.2        584   DTSDSGYGTLIPGTPTGSRSPLSRLRQRALRRDPRLTFSTLELRDIPLRP   633
XP_001118229.2     590   DTSDSGYGTLIPGTPTGSRSPLSRLRQRALRRDPRLTFSTLDLRDVPLRP   639
XP_534913.2        594   DTSDSGYGTLISGSPKGPHY-VSRLRPQALRRDPRLTFSTLDLRDVPLRP   642
XP_003586191.1     582   DTSDSGYGTLIPGSPKESHSSLSRLRLRALRRDPRLTFSTLELRDVPLRP   631
NP_941006.2        585   DASDSGYGTLIPSSPKDSHSPLNRLRSKALRRDPRLTFSTLELRDVPLRP   634
XP_006237465.1     580   DTSDSGYGTLIPSSPKDSQSPLNRLRSKALRRDPRLTFSTLELRDVPLRP   629


NP_060643.2        634   HPPDPQAPQRRSAPELPEGIL-KGGSLPQEDPPTWSEEEDGASERGNVVV   682
XP_522333.2        634   HPPDPQAPQRRSAPELPEGIL-KGGSLPQEDPPTWSEEEDGASERRNVVV   682
XP_001118229.2     640   QPPNPQAPQRRSAPELPEGIL-KGASLPQGDPPTWSEEEEGASVRGNVVV   688
XP_534913.2        643   RPANPQAPQRRSAPELPRQVIRRGSSLPRGDTPTWSEEEDGTSVGGNVVV   692
XP_003586191.1     632   QPSDPQAPQRRSAPVLPEEGVRKAGSLPRVDPPTWSEEEDRTSTGENVVV   681
NP_941006.2        635   QPPDPQAPQRRSAPELPEGIL-RGGSLPRRAPPIWSEEEDETLASGNVVV   683
XP_006237465.1     630   QPPDPQALQRRSAPEMPEGIL-RGGSLPRRAPPTWSEEEDETLTPGNVVV   678


NP_060643.2        683   ETLHRARLRGQLPSSPTHADSAGESPWESSGEEEEEGPLFLKAGHTSLRP   732
XP_522333.2        683   ETLHRARLRGQLPSSPTHADSAGESPWESSGEEEEEGPLFLKAGHTSLRP   732
XP_001118229.2     689   ETLHRAQLRGQLPSSPAHADSAGESPWESSGEEEEEGPLFLRAGHTSLHP   738
XP_534913.2        693   ETLHRAQLWGQHPPSPTHTDSAGESPWESSGDEEEVSHFVGPDCTPSPRP   742
XP_003586191.1     682   ETLQRAQLRGQLCPSPTHADSSEESPWESSGDEEEGYLFQGPDYTPSPHP   731
NP_941006.2        684   ETLHRAQRRSPLPHSPTHTDSAGESPWESS--DEDEGLL-----SPELRP   726
XP_006237465.1     679   ETLSRAQRRSPLPHSPAHTDSAGESPWEST--DEDEGPL-----SPGLRP   721


NP_060643.2        733   --MRAEDMLREIREELASQRIEGAEEPR--DSRPRKLTRAQLQRMRGPHI   778
XP_522333.2        733   --MRAEDMLREIREELASQRIEGAEEPR--DSRPRKLTRAQLQRMRGPHI   778
XP_001118229.2     739   --MRAEDMLREIREELASQRIEGARGVR----KAEDLWHASLPEEISPQ-   781
XP_534913.2        743   --LRAEDMLREIREELASQRIEGLQEPG--NSRPRKLTRGQLQRMRGPYI   788
XP_003586191.1     732   --LRPEDMLREIREELASQRIEGVPEPG--DSRPRKLTRVQLQRMRGSHV   777
NP_941006.2        727   RSLR-EDMLREIREELANQRIDGASEPEPGNGKPRRLTLAQLQRMRVPHI   775
XP_006237465.1     722   RSLRAEDMLREIREELASQRIEGALEPEPGNGKLRRLTRAQLQRMRGHHV   771


NP_060643.2        779   IQLDTPLSASEV   790
XP_522333.2        779   IQLDTPLSASEV   790
XP_001118229.2           ------------
XP_534913.2        789   IQLDTPLSTSEV   800
XP_003586191.1     778   VHLDTPLSTSDV   789
NP_941006.2        776   IQLDTPLSTSEV   787
XP_006237465.1     772   IQLDTPMSTSDV   783


Protein Acc. Gene Organism
NP_060643.2 PLEKHG6 H.sapiens
XP_522333.2 PLEKHG6 P.troglodytes
XP_001118229.2 PLEKHG6 M.mulatta
XP_534913.2 PLEKHG6 C.lupus
XP_003586191.1 PLEKHG6 B.taurus
NP_941006.2 Plekhg6 M.musculus
XP_006237465.1 Plekhg6 R.norvegicus


Support Center