Display Settings:

Format

Send to:

Choose Destination
HomoloGene:31779. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001167567.1       1   MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEE-SVTD   49
XP_003312560.1       1   -----------------MKVTNYNTVVETNSDSDDEDKLHIVEEE-SVTD   32
XP_001089463.2       1   --------------MATCAVTNYNTVVETNSDSDDEDKLHIVEEE-SVTD   35
XP_003638927.1       1   MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEE-SITD   49
NP_001193519.1       1   MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEE-SITD   49
NP_035676.1          1   MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEE-SITD   49
NP_037296.1          1   ---MWYIYTMEYYSAIKNDFMKF------------VGKWLKLESI-ILSE   34
NP_990462.1          1   MADGPRCKRRKQANPRRNNVTNYNNVIEANSDSDDEDKLHIVEEE-SITD   49
NP_571784.1          1   MADGPRCKRRKQANPRRTNVSNYSHVLEGQSDSDDEDKLHIVEEEGSLLD   50
NP_001015808.1       1   MADGPRCKRRKQANPRRNNVTNYNSVLEANSDSDDEDKLHIVEEE-SVTD   49


NP_001167567.1      50   AADCE-GVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDTGKEGQEILGPE   98
XP_003312560.1      33   AADCE-GVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDTGKEGQEILGPE   81
XP_001089463.2      36   AADCE-GVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDTGKEGQEILGPE   84
XP_003638927.1      50   AADCEGGVPEDDLPTDQTVLPG-SSEREGNAKSCWEDNAGKEGQEILGPE   98
NP_001193519.1      50   AADCEGGVPDDDLPSDQTVLPG-SSAREGSAKSCWEDDAGKEGQEILGPE   98
NP_035676.1         50   AADCEGGMPDDELPADQTVLPG-GSDRGGGAKNCWQDN------------   86
NP_037296.1         35   LTQSQKDI-----------------------------H------------   43
NP_990462.1         50   AADCDASVPEDDLPTDHTVLPE-NSEREGSTNSCWEDE-GKETKEILGPE   97
NP_571784.1         51   GADCDSVAPDDD--------PNGTADPDGR----WDDV------------   76
NP_001015808.1      50   AADGEGSVPEDDLPTDQTVLPEGSESAKGSGKTCWEDE------------   87


NP_001167567.1      99   AQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQ   148
XP_003312560.1      82   AQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQ   131
XP_001089463.2      85   AQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQ   134
XP_003638927.1      99   AQADEARCAVKDDECDSDAENEQNHDPNVEEFLQQQDTAVIYPEAPEEDQ   148
NP_001193519.1      99   ARADEVGCAVKDDECDSDAENEQNHDPNVEEFLQQQDTAVIYPEAPEDDQ   148
NP_035676.1         87   ---------VKDNECDSDAENEQNHDPNVEEFLQQQDTAVIYPEAPEEDQ   127
NP_037296.1         44   ---------VKDDECDSDAENEQNHDPNVEEFLQQQDTAVIYPEAPEEDQ   84
NP_990462.1         98   AQSDEVGCTVKEDECDSDAENEQNHDPNVEEFLQQEDTAVIYPEAPEEDQ   147
NP_571784.1         77   -----------KEECVSD-EDERSRDALVEEMLQQGDTAVIFPEAPDDEP   114
NP_001015808.1      88   ---------VKDEECDSDLENEQNQDPNVEEFLQQSDTAVIYPEAPEDDQ   128


NP_001167567.1     149   RQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   198
XP_003312560.1     132   RQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   181
XP_001089463.2     135   RQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   184
XP_003638927.1     149   RQGTPEASGHDDSGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   198
NP_001193519.1     149   RQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   198
NP_035676.1        128   RQGTPEASSHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   177
NP_037296.1         85   RQGTPEASGHDDNGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   134
NP_990462.1        148   RQGTPEASGQDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   197
NP_571784.1        115   RQGTPETSGHDENGTPDSFSQLLTCPYCSRGYKRYTSLKEHIKYRHEKSE   164
NP_001015808.1     129   RQGTPEAVGQDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNE   178


NP_001167567.1     199   DNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQS--GCNRKFKCTEC   246
XP_003312560.1     182   DNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQS--GCNRKFKCTEC   229
XP_001089463.2     185   DNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQS--GCNRKFKCTEC   232
XP_003638927.1     199   DNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQS--GGNRKFKCTEC   246
NP_001193519.1     199   DNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQS--GGNRKFKCTEC   246
NP_035676.1        178   DNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQS--GGNRKFKCTEC   225
NP_037296.1        135   DNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQS--GGNRKFKCTEC   182
NP_990462.1        198   DNFSCSLCSYTFAYRTQLDRHMTSHKSGRDQRHVTQS--SGNRKFKCTEC   245
NP_571784.1        165   DNFSCSLCSYTFAYRTQLDRHMTAHKAGREQRHVTQSGGGGNRKFKCTEC   214
NP_001015808.1     179   DNFSCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQS--GGNRKFKCPEC   226


NP_001167567.1     247   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISL   296
XP_003312560.1     230   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISL   279
XP_001089463.2     233   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISL   282
XP_003638927.1     247   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISL   296
NP_001193519.1     247   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISL   296
NP_035676.1        226   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISL   275
NP_037296.1        183   GKAFKYKHHLKEHLRIHS--------------------------------   200
NP_990462.1        246   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGL   295
NP_571784.1        215   GKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKCIGL   264
NP_001015808.1     227   GKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGV   276


NP_001167567.1     297   IPVNGRPRT-----GLKTSQCSSPSLSASPGSPTRPQIRQKIEN-KPLQE   340
XP_003312560.1     280   IPVNGRPRT-----GLKTSQCSSPSLSASPGSPTRPQIRQKIEN-KPLQE   323
XP_001089463.2     283   IPVNGRPRT-----GLKTSQCSSPSLSASPGSPTRPQIRQKIEN-KPLQE   326
XP_003638927.1     297   MPVNGRPRT-----GLKTPQCSSPSLSASPGSPTRPQIRQKIEN-KPLQE   340
NP_001193519.1     297   MPVNGRPRT-----GLKTSQCSSPSLSASPGSPTRPQMRQKIEN-KPLQE   340
NP_035676.1        276   MPVNGRPRS-----GLKTSQCSSPSLSTSPGSPTRPQIRQKIEN-KPLQE   319
NP_037296.1        201   ------------------------------GSPTRPQIRQKIEN-KPLQE   219
NP_990462.1        296   MPVKGRARS-----GLKTSQCSSPSLSASPGSPARPQIRQKIEN-KPLQE   339
NP_571784.1        265   ISVNGRPRPSPATGAAKTPQCSSPYLPTS-SPTARVQVRDKLDNSKPLQE   313
NP_001015808.1     277   APVNGRVRS-----GLKTPQCSSPSLSASPGSPARPQIRQKIEN-KPLQE   320


NP_001167567.1     341   QLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQG   390
XP_003312560.1     324   QLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQG   373
XP_001089463.2     327   QLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQG   376
XP_003638927.1     341   QLSINQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGGGPLQATSSPQG   390
NP_001193519.1     341   QLPVNQIKTEPVDYEFKPIVVASGINCSAPLQNGVFSGGGPLQATSSPQG   390
NP_035676.1        320   PLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSSGGQLQATSSPQG   369
NP_037296.1        220   PLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGGGQLQATSSPQG   269
NP_990462.1        340   QLPVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGGSPLQATSSPQG   389
NP_571784.1        314   QLPLTQIKSEPLDYEYKPVVVAP----SARGVNGMFQGG----AAAPLQG   355
NP_001015808.1     321   QIPVNQIKTEPVDYEIKPIVVTSGINCSAPLQNGVFSSGSRLQATNSPQG   370


NP_001167567.1     391   MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASK   440
XP_003312560.1     374   MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASK   423
XP_001089463.2     377   VVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQASLASK   426
XP_003638927.1     391   VVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQASLASK   440
NP_001193519.1     391   VVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASK   440
NP_035676.1        370   VVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLETNQASLASK   419
NP_037296.1        270   VVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNIIRQVLENNQASLASK   319
NP_990462.1        390   VVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNHANLASK   439
NP_571784.1        356   AVQAVVLPTVGLVSPISINLGDLQNVLKVAVDGNVIRQVLESTQAKGQQA   405
NP_001015808.1     371   VVQAVVLPTMGLVSPISINLNDIQNVLKVAVDGNVIRQVLENNHVSLASK   420


NP_001167567.1     441   EQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP   490
XP_003312560.1     424   EQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP   473
XP_001089463.2     427   EQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP   476
XP_003638927.1     441   EQETISASSIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP   490
NP_001193519.1     441   EQETINASSIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP   490
NP_035676.1        420   EQEAVSASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP   469
NP_037296.1        320   EQEAVSASSIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPGQLQVVP   369
NP_990462.1        440   EQETISNASIQQAGHSLISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP   489
NP_571784.1        406   GTGIVGAGGIAQATQQVIQAISLPILDQDGNAKIFINYSLD-PSQAQAVL   454
NP_001015808.1     421   EQGTLTSATIQQAGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLPLVA   470


NP_001167567.1     491   QNLKKEN-PVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCP   539
XP_003312560.1     474   QNLKKEN-PVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCP   522
XP_001089463.2     477   QNLKKEN-PVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCP   525
XP_003638927.1     491   QNLKTEN-PVPTNSCKSEKLPEDLTVKSEKDKNFEGGVNDSTCLLCDECP   539
NP_001193519.1     491   QNLKKET-PVPTTNCKSEKLPEDLTVKSEKDKSFEGGGNDSTCLLCDDCP   539
NP_035676.1        470   QNLKKEI-PAPTNSCKSEKLPEDLTVKSETDKSFEGARDDSTCLLCEDCP   518
NP_037296.1        370   QNLKKEN-PAPPKSCKSEKSPEDLTVKSEKDKSFDGAADESTCLLCEDCP   418
NP_990462.1        490   QNLKKEH-SVPTNSCKNEKLPEDLTVKSEKDKNFEGETNDSTCLLCDDCP   538
NP_571784.1        455   QSPKKEPLGSNTEVCKGQKLPEDLTVKTNRDKTT--LTVDEKSMLHNDIL   502
NP_001015808.1     471   QNLKKEA-TAPAEVCKTEKLPEDLTIKTEKDTKF---TEESTCLLGADHP   516


NP_001167567.1     540   GDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPP   589
XP_003312560.1     523   GDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPP   572
XP_001089463.2     526   GDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPP   575
XP_003638927.1     540   GDINALPELKHYDLKQPAQPPPLPAPEAEKPESSVSSG-GDGNLSPSQPP   588
NP_001193519.1     540   GDLNALPELKHYDLKQPAQPPPPPTPEAAKPEAAASSGSGDGSLSPSQPP   589
NP_035676.1        519   GDLNALPELKHYDPECPAQPPP-PAPATEKPESSASSA-GNGDLSPSQPP   566
NP_037296.1        419   GDLNALPELKHYDPEHPAQPPP-PAPATEKPESSASSA-GNGDLSPSQPP   466
NP_990462.1        539   GDLNALQELKHYETKNPPQLPQSSGTEAEKPSSPAPSETGENNLSPGQPP   588
NP_571784.1        503   --------LKHC-----------GKDEHRINGKNLEEKMDLEGLCPGQPP   533
NP_001015808.1     517   GDKNALQEPKHYDQKKNSLLPESSKAEPIKSEPTSADP-EDGNLTPSQPP   565


NP_001167567.1     590   LKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQIS   639
XP_003312560.1     573   LKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQIS   622
XP_001089463.2     576   LKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQIS   625
XP_003638927.1     589   LKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQIS   638
NP_001193519.1     590   LKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQIS   639
NP_035676.1        567   LKNLLSLLKAYYALNAQPSTEELSKIADSVNLPLDGVKKWFEKMQAGQIP   616
NP_037296.1        467   LKNLLSLLKAYYALNAQPSTEELTKIADSVNLPLDVVKKWFEKMQAGQIP   516
NP_990462.1        589   LKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQIS   638
NP_571784.1        534   LKNLLSLLKAYFALNNEPTKEELAKISESVSLPAEVVKKWFEKMQLGQIS   583
NP_001015808.1     566   LKNLLSLLKAYYALNAQPSSEELSKIADSVNLPLDVVKDWFEKMQSGEIS   615


NP_001167567.1     640   VQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDST-VNLQSPLKMTNSP   688
XP_003312560.1     623   VQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDST-VNLQSPLKMTNSP   671
XP_001089463.2     626   VQSSEPSSPEPGKVNIPSKNNDQPQSANANEPQDST-VNLQSPLKMTNSP   674
XP_003638927.1     639   VQSSEPSSPETGKVNIPTKNDEQPQSTNANEPLDST-VNLQSPLKMTNSP   687
NP_001193519.1     640   VQSSEPSSPEPGKANTPAKSNDQPQAADADEAQDST-GNRQSPLKRASSP   688
NP_035676.1        617   GQSPDPPSPGTGSVNIPTKTDEQPQPADGNEPQEDS-TRGQSPVKIRSSP   665
NP_037296.1        517   GQSLEPPSPGPGSGNIPAKTEEQPQPVDGNEPQEDS-TRGQSPLKMTSSP   565
NP_990462.1        639   VQSSGPSSPEQVKISSPTDNDDQAATTNESEPQNST-NNSQNPANTSKSQ   687
NP_571784.1        584   MDPSSPQHEE--EQTTPVDLDGTKGASPKPDLDEQM-NSEKQEERECCSP   630
NP_001015808.1     616   VESSRPSSPKPGQDSV---TENSVESKDESGLHNGTNVSLKSPKQEPEEP   662


NP_001167567.1     689   VLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVE----   734
XP_003312560.1     672   VLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVE----   717
XP_001089463.2     675   VLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVE----   720
XP_003638927.1     688   VLPAGSTTNGSRSSPSSPSPLNLSSSRNTQGYLYTAEGAQEEPQVE----   733
NP_001193519.1     689   VLPGGSAVNGSRSSASSPSPLNLSSSRSAQGYSYPTEGAQEEPQVE----   734
NP_035676.1        666   VLPVGSAMNGSRSCTSSPSPLNLCSARNPQGYSCVAEGAQEEPQVE----   711
NP_037296.1        566   VLPVGSAINGSRSCTSSPSPLNLSSARNPQGYSCVSEGTQEEPQVE----   611
NP_990462.1        688   TSSGGSTQNGSRSSTPSPSPLNLSSSRNSQGYTYTAEGVQEEPQME----   733
NP_571784.1        631   AEGIAASVNGIESVPASPSPLNLS-----------ADGPVPARTLEEGEG   669
NP_001015808.1     663   L-----AVNGPESGTASPTPLNLSSLKNSEGAACSDGTPDGEQQAE----   703


NP_001167567.1     735   PLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCV   784
XP_003312560.1     718   PLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCV   767
XP_001089463.2     721   PLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCV   770
XP_003638927.1     734   PLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCV   783
NP_001193519.1     735   PLDLSLPKQQGELLERPTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCV   784
NP_035676.1        712   PLDLSLPKQQGELLERSTVSSVYQNSVYSVQEEPLNLSCAKKEPQKDSCV   761
NP_037296.1        612   PLDLSLPKQQGELLERSTVSSVYQNSVYSVQEEPLNLSCAKKEPQKDSCV   661
NP_990462.1        734   PLDLSLPKQHGELLERSTITSVYQNSVYSVQEEPLNLTCAKKEPQKDNSI   783
NP_571784.1        670   PLDLSLPKSA----TTASVASGHANTVYSAQEEPLNLTCTKKELLSNAS-   714
NP_001015808.1     704   PLDLSLPKPHGNVPERPSITSVYQSSSYSVQEEPLNLSCVKKEPMQVDDV   753


NP_001167567.1     785   TDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   834
XP_003312560.1     768   TDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   817
XP_001089463.2     771   TDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   820
XP_003638927.1     784   TDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   833
NP_001193519.1     785   TDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   834
NP_035676.1        762   TDSEPVVNVVPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   811
NP_037296.1        662   TDSEPVVNVVPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   711
NP_990462.1        784   TDSDPIVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANK   833
NP_571784.1        715   --TNAAIYASQPSANPINI----MTTQLPTLVAITDQGQAQCLRALTTTK   758
NP_001015808.1     754   TKAEPML-IINPSANPINIAIPTVTAQLPTIVAIADQNGVPCLRALAASK   802


NP_001167567.1     835   QTILIPQVAYTYSTT-VSPAVQEPPLKVI-QPNGNQDERQDTSSEGVSNV   882
XP_003312560.1     818   QTILIPQVAYTYSTT-VSPAVQEPPLKVI-QPNGNQDERQDTSSEGVSNV   865
XP_001089463.2     821   QTILIPQVAYTYSTT-VSPAVQEPPLKVI-QPNGNQDERQDTSSEGVSNV   868
XP_003638927.1     834   QTILIPQVAYTYSTT-VSPAVQEPPLKVI-QPNGNQEERQDTSSEGVSNV   881
NP_001193519.1     835   QTILIPQVAYTYSTA-VSPAVQETPLKVI-QPSGNQDERQDTSSEGVSNV   882
NP_035676.1        812   QTILIPQVAYTYSAT-VSPAVQEPPVKVI-QPNGNQDERQDTSSEGVSTV   859
NP_037296.1        712   QTILIPQVAYTYSAT-VSPAMQEPPVKVI-QPNGNQDERQDTSSEGVS-V   758
NP_990462.1        834   QTILIPQVAYTYSTT-VSPAVQETPPKQT-QANGSQDERQDTSSEGVSNV   881
NP_571784.1        759   QTILIPQLTYSYTTTSSSPAGTDTPQKNILHVNGIKEEKQEMGSEATSIL   808
NP_001015808.1     803   RTILIPQVTYTYSTT-ANPSVPEPQLKNI-QPNGNQDERQDTSSEGVSNV   850


NP_001167567.1     883   EDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   932
XP_003312560.1     866   EDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   915
XP_001089463.2     869   EDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   918
XP_003638927.1     882   EDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   931
NP_001193519.1     883   EDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   932
NP_035676.1        860   EDQNDSDSTPPKKKTRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   909
NP_037296.1        759   EDQNDSDCTPPKKKTRKAENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   808
NP_990462.1        882   EDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRP   931
NP_571784.1        809   EEQTDSDSGPTKKKMKRTESGLYACDLCDKIFQKSSSLLRHKYEHTGKRP   858
NP_001015808.1     851   EDQNDSDSTPPKKKLKKTENGLYACDLCDKIFQKSSSLLRHKYEHTGKRP   900


NP_001167567.1     933   HECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   982
XP_003312560.1     916   HECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   965
XP_001089463.2     919   HECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   968
XP_003638927.1     932   HECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   981
NP_001193519.1     933   HECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   982
NP_035676.1        910   HECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   959
NP_037296.1        809   HECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   858
NP_990462.1        932   HECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   981
NP_571784.1        859   HECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   908
NP_001015808.1     901   HECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNH   950


NP_001167567.1     983   RYSYCKREAEER---DSTEQEEAGPEILSN----EHVGARASPSQGDSDE   1025
XP_003312560.1     966   RYSYCKREAEER---DSTEQEEAGPEILSN----EHVGARASPSQGDSDE   1008
XP_001089463.2     969   RYSYCKREAEER---DSTEQEEAGPEILSN----EHVGARASPSQGDSDE   1011
XP_003638927.1     982   RYSYCKREAEER---DSTEQEEAGPEVLAS----EHVGARGSPSQADSDE   1024
NP_001193519.1     983   RYSYCKREAEER---EPPEPGAAGPGVPPE----QHAG------QGDSDE   1019
NP_035676.1        960   RYSYCKRGAEDR---DAMEQEDAGPEVLPEVLATEHVGARASPSQADSDE   1006
NP_037296.1        859   RYSYCKRGAEDR---DAMEQEDTGPEALPEVLPTELVGARASPSQADSDE   905
NP_990462.1        982   RYSYCKREAEER---DSTEQEEVGQEVLSS----EHAGARASPSQIDSDE   1024
NP_571784.1        909   RYSYCKKEAQGQGLGQGVEEEDNPGEEQPQ----TGSTATSPPSHLDSDE   954
NP_001015808.1     951   RYSYCKKEAEER---DGMEQEESAQEILGN----ENVDSQVSPSQIDSDE   993


NP_001167567.1    1026   RESLTREEDEDSEK--EE----EEEDKEMEELQEEKECEKPQGD-EEEE-   1067
XP_003312560.1    1009   RESLTREEDEDSEK--EE----EEEDKEMEELQEEKECEKPQGDEEEEE-   1051
XP_001089463.2    1012   RESLTREDDEDSEK--EE----EEEDKEMEELQEEKECEKPQGDEEEEE-   1054
XP_003638927.1    1025   RESLMREEDEDSEK-EEE----EEEDKEMEELQEEKECEKPQGE-EEEE-   1067
NP_001193519.1    1020   RESSTREEDEDSEKEEEE----EEEERELEELEEEKGSGAARGAEEVEEE   1065
NP_035676.1       1007   RESLTREEDEDSEK--EE----EEEDKEMEELQEGKECENPQGEEEEEEE   1050
NP_037296.1        906   RESLTREEDEDSEK--EE----EEEDKEMEELQEDKECENPQEEEEEEEE   949
NP_990462.1       1025   RESLTREEEEDSEK-EEE----EEEEKDVEGLQEEKECRKLQDVEEEEE-   1068
NP_571784.1        955   RGSSTRDDESEEEDEMGSGSLVDEDEIQVVKIGEEGDEDDQGADEDQERM   1004
NP_001015808.1     994   RESITREEDSEKEEEDKE----EDDKEEEDEKEEDKEEEEKEEEDEKEED   1039


NP_001167567.1    1068   ----EEEEEVE-------EEEVEEAENEGEEAKTEGLMKDDR--------   1098
XP_003312560.1    1052   ----EEEEEVE-------EEEVEEAENEGEEAKTEGLMKDDR--------   1082
XP_001089463.2    1055   ----EEEEEAE-------EEEVEDAENEGEAAKPEGLMKDDRICFSFSLR   1093
XP_003638927.1    1068   ----EEEDEME-------EEEGEEAENEGEEAKTEGLMKEDE--------   1098
NP_001193519.1    1066   VEDGEEEMDDE-------EDEDEEAEDDGERAETEGVGQGAG--------   1100
NP_035676.1       1051   EEEEEEEEEEE-------EVEADEAEHE-AAAKTDGTVEVG---------   1083
NP_037296.1        950   EEEEEEEEEEE---------EAEEAEHEAAAAKTGGAVEEE---------   981
NP_990462.1       1069   ----VEEEEEE------------------EEGKTEGNKNDD---------   1087
NP_571784.1       1005   EEDGDEEGEGETLKVVVMQDECEEDENEEDEQTSEDAMDT----------   1044
NP_001015808.1    1040   EKDMDDGQEEK-------EHVGEGEMEEGEAEPLAGTLKDEE--------   1074


NP_001167567.1    1099   --------------------------------------AESQA------S   1104
XP_003312560.1    1083   --------------------------------------AESQA------S   1088
XP_001089463.2    1094   ILEGGKGENIFSTGIFKANYKLHVFNHRYLQKMLCSTIAETQTGDAALVS   1143
XP_003638927.1    1099   --------------------------------------VVNQE------S   1104
NP_001193519.1    1101   --------------------------------------AGGQA------H   1106
NP_035676.1       1084   --------------------------------------AAQQA------G   1089
NP_037296.1        982   --------------------------------------AAQQA------G   987
NP_990462.1       1088   --------------------------------------VVNRA------S   1093
NP_571784.1       1045   --------------------------------------SDHTE------E   1050
NP_001015808.1    1075   --------------------------------------CVEED------K   1080


NP_001167567.1    1105   SLGQKV-------GESSEQ-------------------------------   1116
XP_003312560.1    1089   SLGQKV-------GESSEQ-------------------------------   1100
XP_001089463.2    1144   SLIQRL-------SRALGQFWSYSKPGLLEGNNFQTFEKGDGNPMCEACI   1186
XP_003638927.1    1105   NLEQKV-------SKNSEQ-------------------------------   1116
NP_001193519.1    1107   SLEHKV-------SEGSEQ-------------------------------   1118
NP_035676.1       1090   SLEQKASESEMESESESEQ-------------------------------   1108
NP_037296.1        988   SFQQKA------SGSESKR-------------------------------   1000
NP_990462.1       1094   NAEPEV-------IQSNGQ-------------------------------   1105
NP_571784.1       1051   MTERKT-------PGDNKN-------------------------------   1062
NP_001015808.1    1081   CLEEEV-------TEEN---------------------------------   1090


NP_001167567.1    1117   -----VSEEKTNEA------------------------------------   1125
XP_003312560.1    1101   -----VSEEKTNEA------------------------------------   1109
XP_001089463.2    1187   RRAVLVEEKEMGQNLNLAVRVRELFPTANIPGDLGVFTEFTTPGASPDLP   1236
XP_003638927.1    1117   -----VSEEKTNEA------------------------------------   1125
NP_001193519.1    1119   -----VSEEKTNEA------------------------------------   1127
NP_035676.1       1109   -----LSEEKTNEA------------------------------------   1117
NP_037296.1       1001   -----LSEEKTNEA------------------------------------   1009
NP_990462.1       1106   -----VSEEKTNKA------------------------------------   1114
NP_571784.1       1063   -----IGEHEGNTA-----------------------------AMNGDVK   1078
NP_001015808.1    1091   -----VSEKALPQP------------------------------------   1099


NP_001167567.1           
XP_003312560.1           
XP_001089463.2           
XP_003638927.1           
NP_001193519.1           
NP_035676.1              
NP_037296.1              
NP_990462.1              
NP_571784.1              
NP_001015808.1           


Protein Acc. Gene Organism
NP_001167567.1 ZEB1 H.sapiens
XP_003312560.1 ZEB1 P.troglodytes
XP_001089463.2 ZEB1 M.mulatta
XP_003638927.1 ZEB1 C.lupus
NP_001193519.1 ZEB1 B.taurus
NP_035676.1 Zeb1 M.musculus
NP_037296.1 Zeb1 R.norvegicus
NP_990462.1 ZEB1 G.gallus
NP_571784.1 zeb1b D.rerio
NP_001015808.1 zeb1 X.tropicalis


Support Center