Display Settings:

Format

Send to:

Choose Destination
HomoloGene:27862. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_775965.2              --------------------------------------------------
XP_003954150.1           --------------------------------------------------
XP_001084697.1           --------------------------------------------------
XP_003435587.1           --------------------------------------------------
XP_002699621.1           --------------------------------------------------
NP_001032952.1           --------------------------------------------------
XP_006257658.1           --------------------------------------------------
XP_004940743.1       1   MFCFLCVGTAALRQQFHWSQRHRLMCSAPTAGTLGCNNLCFLLAQPGLEP   50
XP_005173285.1           --------------------------------------------------
XP_002932642.2           --------------------------------------------------


NP_775965.2          1   ------------------------------------MQMVPSL-------   7
XP_003954150.1       1   ------------------------------------MQMVPSL-------   7
XP_001084697.1       1   ------------------------------------MQMVPSL-------   7
XP_003435587.1       1   ------------------------------------MQLVPSF-------   7
XP_002699621.1       1   ------------------------------------MQRVPPS-------   7
NP_001032952.1       1   ----------------------------------MFRRTLNRL-------   9
XP_006257658.1       1   ----------------------------------MFRRTLNRL-------   9
XP_004940743.1      51   TVWYGSVGRWEPSMWSSRRELQSCLGVTLRSALVMMSHLLPPQLHCWQCH   100
XP_005173285.1       1   -----------------------MELSARSVEEETTRQTLSFF-------   20
XP_002932642.2       1   ----------------------------------MFRLGCSRL-------   9


NP_775965.2          8   --PPASECAGEEKRVGTRTVFVGNHPVSETEAYIAQRFCDNRIVSSKYTL   55
XP_003954150.1       8   --PPASECAGEEKRVGTRTVFVGNHPVSETEAYIAQRFCDNRIVSSKYTL   55
XP_001084697.1       8   --PSASECAGEEKRVGTRTVFVGNHSVSGTEAYVAQRFCDNRIVSSKYTL   55
XP_003435587.1       8   --PPASECAGEEKRVGTRTVFVGNHPVSETEAYIAQRFCDNRIVSSKYTL   55
XP_002699621.1       8   --SPASECAGEEKRVGTRTVFVGNHPVSETEAYIAQKFCDNRIISSKYTL   55
NP_001032952.1      10   -------CAGEEKRVGTRTVFVGNHPISGTEPYIAQRFCDNRIVSSKYTL   52
XP_006257658.1      10   -------CAGEEKRVGTRTVFVGNHPISGTEAYIAQRFCDNRIVSSKYTL   52
XP_004940743.1     101   MDANSPQCAGEEKRVGTRTVVVGHRPVSEADAYVAQKFCDNRIVSSKYTV   150
XP_005173285.1      21   ----CNECGGDERRVDSRTIYVGHRPCPDTEAFIPPKFCDNRIVSSKYTV   66
XP_002932642.2      10   -------CPGEENRVGTRTVYVGPRSASETDAYIQPKFCDNRIVSSKYTI   52


NP_775965.2         56   WNFLPKNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVT   105
XP_003954150.1      56   WNFLPKNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVT   105
XP_001084697.1      56   WNFLPKNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVT   105
XP_003435587.1      56   WNFLPKNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVT   105
XP_002699621.1      56   WNFLPKNLFEQFRRIANFYFLIIFLIQVTVDTPTSPITSGLPLFFVITVT   105
NP_001032952.1      53   WNFLPKNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVT   102
XP_006257658.1      53   WNFLPKNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVT   102
XP_004940743.1     151   WNFLPKNLFEQFRRIANFYFLIIFLVQVIVDTPTSPVTSGLPLFFVITVT   200
XP_005173285.1      67   WNFLPKNLFEQFRRIANFYFLIIFLVQVIVDTPTSPVTSGLPLFFVITVT   116
XP_002932642.2      53   WNFIPKNLFEQFRRIANFYFLIIFLIQAIVDTPTSPVTSGLPLFFVITVT   102


NP_775965.2        106   AIKQGYEDWLRHRADNEVNKSTVYIIENAKRVRKESEKIKVGDVVEVQAD   155
XP_003954150.1     106   AIKQGYEDWLRHRADNEVNKSTVYIIENAKRVRKESEKIKVGDVVEVQAD   155
XP_001084697.1     106   AIKQGYEDWLRHRADNEVNKSTVYIIENAKRVRKESEKIKVGDVVEVQAD   155
XP_003435587.1     106   AIKQGYEDWLRHRADNEVNKSTVYIIENAKRVRKESEKIKVGDVVEVQAD   155
XP_002699621.1     106   AIKQGYEDWLRHRADNEVNKSTVYIIENAKRVKKESEKIKVGDIVEVQAD   155
NP_001032952.1     103   AIKQGYEDWLRHRADNEVNKSAVYIIENAKRVRKESEKIKVGDVVEVQAN   152
XP_006257658.1     103   AIKQGYEDWLRHRADNEVNKSTVYIIENAKRVRKESEKIKVGDVVEVQAD   152
XP_004940743.1     201   AIKQGYEDWLRHRADNEVNKSNVFIIENAKQVQKESEKIKVGDIVEVKAD   250
XP_005173285.1     117   AIKQGYEDWLRHKADNEVNKYPVTVLEDGRSVKKESEKIKVGDVVEVVED   166
XP_002932642.2     103   AIKQGYEDWLRHRADHEVNKSTVYVIEGSKCVKKESEKIKVGDIVEVRDN   152


NP_775965.2        156   ETFPCDLILLSSCTTDGTCYVTTASLDGESNCKTHYAVRDTIALCTAESI   205
XP_003954150.1     156   ETFPCDLILLSSCTTDGTCYVTTASLDGESNCKTHYAVRDTIALCTAESI   205
XP_001084697.1     156   ETFPCDLILLSSCTTDGTCYVTTASLDGESNCKIHYAVRDTIALCTAESI   205
XP_003435587.1     156   ETFPCDLILLSSCTSDGTCYVTTASLDGESNCKTHYAVRDTIALHTAESI   205
XP_002699621.1     156   ETFPCDLILLSSCTVDGTCYVTTASLDGESNCKTHYAVRDTIELRTVESI   205
NP_001032952.1     153   ETFPCDLILLSSCTTDGTCYVTTASLDGESNCKTHYAVRDTIALCTAESI   202
XP_006257658.1     153   ETFPCDLILLSSCTTDGTCYVTTASLDGESNCKTHYAVRDTIELCTAESI   202
XP_004940743.1     251   ETFPCDLIFLASSSTDGTCYVTTASLDGESNFKTHYAVRDTTVLCTDEAI   300
XP_005173285.1     167   ETFPCDLILLQSSREDGTCFVTTASLDGESNHKTHYTVPD-----IERDL   211
XP_002932642.2     153   ETFPCDLVMLSTSCRDGTCTVTTASLDGESNFKTYHAVPETAILGTYEDL   202


NP_775965.2        206   DTLRAAIECEQPQPDLYKFVGRINIYSNSLEAVARSLGPENLLLKGATLK   255
XP_003954150.1     206   DTLRAAIECEQPQPDLYKFVGGINIYSNSLEAVARSLGPENLLLKGATLK   255
XP_001084697.1     206   DTLRAAIECEQPQPDLYKFVGRINIYSNSLEAVARSLGPENLLLKGATLK   255
XP_003435587.1     206   DTLRAAIECEQPQPDLYKFVGRISIYSNSLEADARSLGPENLLLKGATLK   255
XP_002699621.1     206   DNLRAAIECEQPQPDLYKFVGRINIYSNSIEAVARSLGPENLLLKGATLK   255
NP_001032952.1     203   DNLRATIECEQPQPDLYRFVGRISIYSNSIEAVARSLGPENLLLKGATLK   252
XP_006257658.1     203   DNLRAAIECEQPQPDLYKFVGRISIYSNSIEAVARSLGPENLLLKGATLK   252
XP_004940743.1     301   DSLTATIECEQPQPDLYKFVGRIIMHRSNQEPVARSLGPENLLLKGATLK   350
XP_005173285.1     212   QVLTAAIECEQPQPDLYKFVGRMHIYKPEQEEAVRSLGPENLLLKGATLK   261
XP_002932642.2     203   NAFSATIECEQPQPDLYKFHGRIDVNTN-QDVKARSLGPENLLLKGATLK   251


NP_775965.2        256   NTEKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFILLTK   305
XP_003954150.1     256   NTEKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFILLTK   305
XP_001084697.1     256   NTEKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFILLTK   305
XP_003435587.1     256   NTKKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFILLTK   305
XP_002699621.1     256   NTKKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFILLTK   305
NP_001032952.1     253   NTKKIYGVAVYTGMETKMALNYQGKSQKCSAVEKSINAFLIVYLFILLTK   302
XP_006257658.1     253   NTKKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFILLTK   302
XP_004940743.1     351   NTKKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLCILLSK   400
XP_005173285.1     262   NTKEIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLLVYLCILISK   311
XP_002932642.2     252   NTKKIYGVAIYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLCILVSK   301


NP_775965.2        306   AAVCTTLKYVWQSTPYNDEPWYNQKTQKERETLKVLKMFTDFLSFMVLFN   355
XP_003954150.1     306   XAVCTTLKYVWQSTPYNDEPWYNQKTQKERETLKVLKMFTDFLSFMVLFN   355
XP_001084697.1     306   AAVCTTLKYVWQSTPYNDEPWYNQKTQKERETLKVLKMFTDFLSFMVLFN   355
XP_003435587.1     306   AAVCTTLKYVWQSTPYNDEPWYNQKTQKERETLKVLKMFTDFLSFMVLFN   355
XP_002699621.1     306   AAICTTLKYVWQSTPHNDEPWYNQKTQKERETWKVLKMFTDFLSFMVLFN   355
NP_001032952.1     303   AAVCTTLKYVWQSSPYNDEPWYNQKTQKERETFQVLKMFTDFLSFMVLFN   352
XP_006257658.1     303   AAVCTTLKYVWQSTPYNDEPWYNQKTQKERETFKVLKMFTDFLSFMVLFN   352
XP_004940743.1     401   ATVCTTLKYVWQSNPFNDEPWYNEKTKKERETFKVLRMFTDFLSFMVLFN   450
XP_005173285.1     312   AVVCTTLKYVWQSKEGQDEPWYNEKTQKEKETNMYLKMFTDFLSFMVLFN   361
XP_002932642.2     302   ATICTSLKYLWQSNPANDEPWYNEKTRKEKEAFKILKMFTDFLSFMVLFN   351


NP_775965.2        356   FIIPVSMYVTVEMQKFLGSFFISWDKDFYDEEINEGALVNTSDLNEELGQ   405
XP_003954150.1     356   FIIPVSMYVTVEMQKFLGSFFISWDKDFYDEEINEGALVNTSDLNEELGQ   405
XP_001084697.1     356   FIIPVSMYVTVEMQKFLGSFFISWDKDFYDEEINEGALVNTSDLNEELGQ   405
XP_003435587.1     356   FIIPVSMYVTVEMQKFLGSFFISWDKDFYDEEIREGALVNTSDLNEELGQ   405
XP_002699621.1     356   FIIPVSMYVTVEMQKFLGSFFISWDNDFYDEEINEGALVNTSDLNEELGQ   405
NP_001032952.1     353   FIIPVSMYVTVEMQKFLGSFFISWDKDFFDEEINEGALVNTSDLNEELGQ   402
XP_006257658.1     353   FIIPVSMYVTVEMQKFLGSFFISWDKDFFDEEINEGALVNTSDLNEELGQ   402
XP_004940743.1     451   FIIPVSMYVTVEMQKFLGSFFISWDKEMYDEEMEEGALVNTSDLNEELGQ   500
XP_005173285.1     362   FIIPVSMYVTVEMQKFLGSFFIKWDNDFFDPEIEEGALVNTSDLNEELGQ   411
XP_002932642.2     352   FIIPVSMYVTVEMQKFLGSFFIAWDMEMFDEEINEGALVNTSDLNEELGQ   401


NP_775965.2        406   VDYVFTDKTGTLTENSMEFIECCIDGHKY--KGVTQEVDGLSQTDGTLTY   453
XP_003954150.1     406   VDYVFTDKTGTLTENSMEFIECCIDGHKY--KGVTQEVDGLSQTDGTLTY   453
XP_001084697.1     406   VDYVFTDKTGTLTENSMEFIECCIDGHKY--KGVTQEVDGLSQTDGPLTY   453
XP_003435587.1     406   VDYIFTDKTGTLTENSMEFIECCIDGHKY--KGVAQEADGLSETDGPLTY   453
XP_002699621.1     406   VDYVFTDKTGTLTENTMEFIECCIDGHKY--KGVAQETDGLSQTDGPLPY   453
NP_001032952.1     403   VDYVFTDKTGTLTENSMEFIECCIDGHKY--KGTTQEVDGLSQTDGPLAY   450
XP_006257658.1     403   VDYVFTDKTGTLTENSMEFIECCIDGHKY--KGTTQEVDGLSQIDGPLAY   450
XP_004940743.1     501   VEFVFTDKTGTLTENSMEFIECCIDGHKY--KGCISEVDGFSQTDGTLKY   548
XP_005173285.1     412   VEYVFTDKTGTLTQNNMEFIECCIDGFQYRHRDAHGELDGFTVTDGPLNK   461
XP_002932642.2     402   VEYVFTDKTGTLTENKMEFIECCIDGHKY--AN-TDAMDGLSLTDG-LAY   447


NP_775965.2        454   F-DKVDKNREELFLRALCLCHTVEIKTN------DAVDGATESAEL--TY   494
XP_003954150.1     454   F-DKVDKNREELFLRALCLCHTVEIKTN------DAVDGATESAEL--TY   494
XP_001084697.1     454   F-DKADKNREELFLRALCLCHTVEIKTN------DAVDGATESAEL--TY   494
XP_003435587.1     454   F-DKADKNREELFLRALCLCHTVEIKTN------DAVDGPTESAKL--TY   494
XP_002699621.1     454   L-DRADKNREELFLRALCLCHTVEVKPN------DTVDGVTESSEL--TY   494
NP_001032952.1     451   F-DKADKNREALFLRALCLCHTVEMKTN------DDVDGPVEGAGF--TY   491
XP_006257658.1     451   F-DKADKNREELFLRALCLCHTVEIKTN------DAVDGPIEGAQF--TY   491
XP_004940743.1     549   Y-GKAEKSREELFLRALCLCHTVRIKQA------DQVDGLIGHPECKNTY   591
XP_005173285.1     462   LQEKAGREKEELFLRALCLCHTVQVKEETLSDQIDGIDGVLPKAEEERGF   511
XP_002932642.2     448   F-GKASQDLEELFLRALCLCHTVQMKEE------CHTDGPSFSSTDNCAY   490


NP_775965.2        495   ISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHTLNFD   544
XP_003954150.1     495   ISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHTLNFD   544
XP_001084697.1     495   ISSSPDEIALVKGAKKYGFTFLGNRNGHMRVENQRKEIEEYELLHTLNFD   544
XP_003435587.1     495   MSSSPDEIALVKGAKKYGFTFVGIRNGHMRIENQRKEIEEYELLHTLNFD   544
XP_002699621.1     495   MSSSPDEIALVKGAKKYGFTFVGVQNGYMRVENQRKEIEEYELLHTLNFD   544
NP_001032952.1     492   ISSSPDEIALVKGAKRFGFTFLGNQNGYIRVENQRKEIEEYELLHTLNFD   541
XP_006257658.1     492   ISSSPDEIALVKGAQKFGFTFLGNWNGHIRVENQRKEIEEYELLHTLNFD   541
XP_004940743.1     592   ISSSPDEIALVKGAEKYGFTFLGLENDFVKIRNQKNETEMYQLLHTLNFD   641
XP_005173285.1     512   IASSPDEVALVKGAMEYGFTFLGLENKNMKIRNRQNDIEEYKLLHVLNFD   561
XP_002932642.2     491   ISSSPDEIALVTGAKRYGFTYMGTENNVMSVENQKNEIERYQLLHVLNFD   540


NP_775965.2        545   AVRRRMSVIVKTQEGDILLFCKGADSAVFPRVQNHEIELTKVHVERNAMD   594
XP_003954150.1     545   AVRRRMSVIVKTQEGDILLFCKGADSAVFPRVQNHEIELTKVHVERNAMD   594
XP_001084697.1     545   AVRRRMSVIVKTQEGDILLFCKGADSAVFPRVQNHEIELTKVHVERNAMD   594
XP_003435587.1     545   SVRRRMSVIVKTQAGDILLFCKGADSAVFPRVQNHEIELTKAHVERNAMD   594
XP_002699621.1     545   AVRRRMSVIVKTQTGDILLFCKGADSAVFPRVQNHEIDLIKVHVEHNAME   594
NP_001032952.1     542   SVRRRMSVIVRTQKGDILLFCKGADSSIFPRVHSHQIELTKDHVERNAMD   591
XP_006257658.1     542   SVRRRMSVIVRTQGGDILLFCKGADSSIFPRVHSHEIDLTKVHVERNAMD   591
XP_004940743.1     642   PVRRRMSVIVRTTTGKLLLFCKGADSSIFPRVQQEEIQQTKVHVDRNALD   691
XP_005173285.1     562   PVRRRMSVIVQTKSGDTLLFCKGADSSIFPRVRPEEVDRIRLHVERNATD   611
XP_002932642.2     541   PVRRRMSVLVKAETGKIFLFCKGADSSMFPRVARDQVQRIKVHVEKNALD   590


NP_775965.2        595   GYRTLCVAFKEIAPDDYERINRQLIEAKMALQDREEKMEKVFDDIETNMN   644
XP_003954150.1     595   GYRTLCVAFKEIAPDDYERINRQLIEAKMALQDREEKMEKVFDDIETNMN   644
XP_001084697.1     595   GYRTLCVAFKEIAPDDYERINRQLIEAKMALQDREEKMEKVFDDIETNMN   644
XP_003435587.1     595   GYRTLCVAFKEIAPDDYERINRQLIEAKMALQDREEKMEKVFDDIETNMN   644
XP_002699621.1     595   GYRTLCIAFKEIAPDDYERVNRQLIEAKMALQDREEKMEKVFDEIETDMH   644
NP_001032952.1     592   GYRTLCVAFKEIPPDDFERINAQLVEAKMALQDREEKLEKVFDEIETNMN   641
XP_006257658.1     592   GYRTLCVAFKEIPPDDFERINVQLIEAKMALQDREEKLEKIFDVIETNMN   641
XP_004940743.1     692   GYRTLCVAFKELTQKEYDRIDRQLNEAKMALQDREEKMAKVFEDTEADMH   741
XP_005173285.1     612   GYRTLCVAYKQLSAEEYALADTGLREARLALQDREEKLMAMYNQVETGMS   661
XP_002932642.2     591   GYRTLCVAFKEVSQELYENINKQLEEAKLALQDREERLAKVYDDIEADMH   640


NP_775965.2        645   LIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLF   694
XP_003954150.1     645   LIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLF   694
XP_001084697.1     645   LIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLF   694
XP_003435587.1     645   LIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLF   694
XP_002699621.1     645   LIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLF   694
NP_001032952.1     642   LIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLF   691
XP_006257658.1     642   LIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLF   691
XP_004940743.1     742   LIGATAVEDRLQEQSAETIEALHAAGMKVWVLTGDKMETAKSTCYACRLF   791
XP_005173285.1     662   LIGATAVEDRLQEEAAETMEALQGAGMKIWVLTGDKMETAKSTCYACRLF   711
XP_002932642.2     641   LLGATAVEDRLQEQAAETIEALHAAGMKVWVLTGDKLETAKSTCYACRLF   690


NP_775965.2        695   QTNTELLELTTKTIEES-ERKEDRLHELLIEYRKKLLHEFPKS-TRSFKK   742
XP_003954150.1     695   QTNTELLELTTKTIEES-ERKEDRLHELLIEYRKKLLHEFPKS-TRSFKK   742
XP_001084697.1     695   QTNTELLELTTKTIEES-ERKEDRLHELLIEYRKKLLHEFPKS-TRSLKK   742
XP_003435587.1     695   QTSTELLELTTKTIEES-ERKEDRLHELLIEYRKKLLHDFPKS-TRSLKK   742
XP_002699621.1     695   QTNTELLELTTKTIEES-ERKEDRLHELLTEYRKKLLHEFPKS-TRSLKK   742
NP_001032952.1     692   QTNTELLELTTKTIEES-ERKEDRLHELLIEYRKKLLHEFPKS-TRSLKK   739
XP_006257658.1     692   QTNTELLELTTKTIEES-ERKEDRLHELLIEYRKKLLHEFPKS-TRSLKK   739
XP_004940743.1     792   QTSTELLELTARVVGES-ERKEDRLHELLMDYHKRLIQDVPKP-RGSLKR   839
XP_005173285.1     712   QRGTELLELTVRTLEDGRSKREDRLLELLRDYHRRAVQDAPPVKTGVVTR   761
XP_002932642.2     691   QSNTELLELTTKDLEEY-ERKEDRLQELLMEYHRKLVQEAPKL-KGGANR   738


NP_775965.2        743   AWTEHQEYGLIIDGSTLSLILNSSQDSSSNNYKSIFLQICMKCTAVLCCR   792
XP_003954150.1     743   AWTEHQEYGLIIDGSTLSLILNSSQDSSSNNYKSIFLQICMKCTAVLCCR   792
XP_001084697.1     743   AWTEHQEYGLIIDGSTLSLILNSSQDSSSNNYKSIFLQICMKCTAVLCCR   792
XP_003435587.1     743   AWTEHQEYGLIIDGSTLSLILNSSQDSSSNNYKSIFLQICMKCTAVLCCR   792
XP_002699621.1     743   AWTEHQEYGLIIDGSTLSLILNSSQDSGSNNYKSIFLQICMKCTAVLCCR   792
NP_001032952.1     740   AWTEHQEYGLIIDGSTLSLILNSSQDCSSNNYKSIFLQICMKCTAVLCCR   789
XP_006257658.1     740   AWTEHQEYGLIIDGSTLSLILNSSQDCSSNNYKSIFLQICMKCTAVLCCR   789
XP_004940743.1     840   SWTLSQEYGLIIDGSTLSLILNPSQDSSSSHYKNIFLQICLKCTAVLCCR   889
XP_005173285.1     762   SWSANQEYGFIIDGATLSLVMNPPRDADASLYRGLFLQICQNCTAVLCCR   811
XP_002932642.2     739   SWTGNQDHGLIIDGATLSLILNS--NCSSSHYKNIFLQICQKCSAVLCCR   786


NP_775965.2        793   MAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVG------IGI   836
XP_003954150.1     793   MAPLQKAQIVRMVKNLKGSPITLSIGDGAIYVSMILESHCGRXRYSLLGI   842
XP_001084697.1     793   MAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVG------IGI   836
XP_003435587.1     793   MAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVG------IGI   836
XP_002699621.1     793   MAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVG------IGI   836
NP_001032952.1     790   MAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVG------IGI   833
XP_006257658.1     790   MAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVG------IGI   833
XP_004940743.1     890   MAPLQKAQIVRMVKNTKGSPITLSIGDGANDVSMILEAHVG------IGI   933
XP_005173285.1     812   MAPLQKAQIVKMVKNCKGSPITLSIGDGANDVSMILEAHVG------IGI   855
XP_002932642.2     787   MAPLQKAQIVKMVKNTKGSPITLSVGDGANDVSMILEAHVG------IGI   830


NP_775965.2        837   KGKEGRQAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLC   886
XP_003954150.1     843   KGKEGRQAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLC   892
XP_001084697.1     837   KGKEGRQAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLC   886
XP_003435587.1     837   KGKEGRQAARNSDYAVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLC   886
XP_002699621.1     837   KGKEGRQASRNSDYAVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLC   886
NP_001032952.1     834   KGKEGRQAARNSDYSVPKFKHLKKLLLVHGHLYYVRIAHLVQYFFYKNLC   883
XP_006257658.1     834   KGKEGRQAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLC   883
XP_004940743.1     934   KGKEGRQAARNSDYAVPKFKHLRKLLLAHGHLYYVRIAHLVQYFFYKNLC   983
XP_005173285.1     856   KGKEGRQAVRNSDYAIPKLKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLC   905
XP_002932642.2     831   KGKEGRQAARSSDYAVPKFKHLRKLLLAHGHLYYVRIAHLVQYFFYKNLC   880


NP_775965.2        887   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   936
XP_003954150.1     893   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   942
XP_001084697.1     887   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   936
XP_003435587.1     887   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   936
XP_002699621.1     887   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   936
NP_001032952.1     884   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   933
XP_006257658.1     884   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   933
XP_004940743.1     984   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINID   1033
XP_005173285.1     906   FILPQFLYQFFCGYSQQPLYDAAYLTMYNICFTSMPILAYSLLEQHIAIE   955
XP_002932642.2     881   FILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSMPILAYSLLEQRINIE   930


NP_775965.2        937   TLTSDPRLYMKISGNAMLQLGPFLYWTFLAAFEGTVFFFGTYFLFQTASL   986
XP_003954150.1     943   SLTSDPRLYMKISGNAMLQLGPFLYWTFLAAFEGTVFFFGTYFLFQTASL   992
XP_001084697.1     937   TLTSDPRLYMKISGNAMLQLGPFLYWTFLAAFEGTVFFFGTYFLFQTASL   986
XP_003435587.1     937   TLTSDPRLYMKISGNAMLQLGPFLYWTFLAAFEGTVFFFGTYFLFQTSSL   986
XP_002699621.1     937   TLTSDPRLYMKISGNAMLQLGPFLYWTFLAAFEGTVFFFGTYFLFQTTSL   986
NP_001032952.1     934   TLTADPRLYMKITGNAMLQLGPFLHWTFLAAFEGTVFFFGTYFLFQTSSL   983
XP_006257658.1     934   ALTADPRLYMKITGNAMLQLGPFLYWTFLAAFEGTVFFFGTYFLFQTTSL   983
XP_004940743.1    1034   TLTSDPQLYMKVSDNAMLQWRPFLYWTFLGAFEGLVFFFGVYFLFQNSSL   1083
XP_005173285.1     956   ILLDNATLYREIAKNAMLRWRPFLYWTVLGIFQGLLFFFGVRFLFSNPAL   1005
XP_002932642.2     931   ILSSNPKLYMRISDNAMLQWGPFLYWTLLGAFEGLVFFFGVYFLFQNPAL   980


NP_775965.2        987   EENGKVYGNWTFGTIVFTVLVFTVTLKLALDTRFWTWINHFVIWGSLAFY   1036
XP_003954150.1     993   EENGKVYGNWTFGTIVFTVLVFTVTLKLALDTRFWTWINHFVIWGSLAFY   1042
XP_001084697.1     987   EENGKVYGNWTFGTIVFTVLVFTVTLKLALDTRFWTWINHFVIWGSLAFY   1036
XP_003435587.1     987   EENAKVYGNWTFGTIVFTVLVFTVTLKLALDTRFWTWINHFVIWGSLAFY   1036
XP_002699621.1     987   DENGKVYGNWTFGTIIFTILVFTVTLKLALDTRFWTWINHLVIWGSLAFY   1036
NP_001032952.1     984   EDNGKIYGNWTFGTIVFTVLVFTVTLKLALDTRFWTWINHFVIWGSLAFY   1033
XP_006257658.1     984   EDNGKIYGNWTFGTIVFTVLVFTVTLKLALDTRFWTWINHFVIWGSLAFY   1033
XP_004940743.1    1084   EDNGKVFGNWTFGTIVFTVLVFTVTLKLALDTRFWTWMNHFVIWGSLAFY   1133
XP_005173285.1    1006   QDNGQVFGNWSYGTIVFTVLVFTVTLKLALDTRHWTWINHFVIWGSLAFY   1055
XP_002932642.2     981   EGNGQVYGNWSFGTMVFTILVFTVTLKLALDTRYWTWMNHLAIWGSLAFY   1030


NP_775965.2       1037   VFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFISLFPEIL   1086
XP_003954150.1    1043   VFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFISLFPEIL   1092
XP_001084697.1    1037   VFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFISLFPEIL   1086
XP_003435587.1    1037   VFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIVLLIFISLFPEIL   1086
XP_002699621.1    1037   VFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSVWLTIILLIFVSLSPEML   1086
NP_001032952.1    1034   VFFSFFWGGIIWPFLKQQRMYFVFAQMLCSVSTWLAIILLIFISLFPEIL   1083
XP_006257658.1    1034   VFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFISLFPEIL   1083
XP_004940743.1    1134   VFFSFFWGGVIWPFLKQQRMYFVFAHMLTSVSTWLAIILLIFISLFPEIL   1183
XP_005173285.1    1056   VFFSFFWGGIIWPFLKQQRLYFVFANMLSSVSAWLVIIILILLSLLPEIL   1105
XP_002932642.2    1031   VIFSLFWGGIIWPFLKQQRMYFVFSHILTSVSIWLGIILLIFVSLYPEIV   1080


NP_775965.2       1087   LIVLKNVRRRSARRNLSCRRASDSLSARPSVR-PLLLRTFSDESNVL---   1132
XP_003954150.1    1093   LIVLKNVRRRSAR--------------NPNLELPMLLSYKHTDSGYS---   1125
XP_001084697.1    1087   LIVLKNVRRRSAR--------------NPNLELPMLLSYKHTDSGYS---   1119
XP_003435587.1    1087   LIVLKNVRRRSARRNLSCKRASDSLSARPSVR-PLLLRTFSDESNIL---   1132
XP_002699621.1    1087   RIVLRSVRRRSTR--------------NPNLELPMLLSYKHIDSGYR---   1119
NP_001032952.1    1084   LIVVKNVRRRSARRNLSCRRASDSLSARPSVR-PLLLRTFSDESNIL---   1129
XP_006257658.1    1084   LIVVKNVRRRSARRNLSCRRASDSLSARPSVR-PLLLRTFSDESNIL---   1129
XP_004940743.1    1184   LIVLKSIKERSHQ---SSRKAPKSMSSRPSVT-PLLLRTFSDESNVL---   1226
XP_005173285.1    1106   LAVLRKPKGPHSRQKKPGQSNVGGIPSSQSSARPLLMRTFSDESNTVI--   1153
XP_002932642.2    1081   LILVKNLKTANQK--------------RISYQPPVLISYKSMENGFISKK   1116


NP_775965.2              -----------
XP_003954150.1           -----------
XP_001084697.1           -----------
XP_003435587.1           -----------
XP_002699621.1           -----------
NP_001032952.1           -----------
XP_006257658.1           -----------
XP_004940743.1           -----------
XP_005173285.1           -----------
XP_002932642.2    1117   KTEDYKLNTFL   1127


Protein Acc. Gene Organism
NP_775965.2 ATP11C H.sapiens
XP_003954150.1 ATP11C P.troglodytes
XP_001084697.1 ATP11C M.mulatta
XP_003435587.1 ATP11C C.lupus
XP_002699621.1 ATP11C B.taurus
NP_001032952.1 Atp11c M.musculus
XP_006257658.1 Atp11c R.norvegicus
XP_004940743.1 ATP11C G.gallus
XP_005173285.1 atp11c D.rerio
XP_002932642.2 LOC100498300 X.tropicalis


Support Center