Display Settings:

Format

Send to:

Choose Destination
HomoloGene:2662. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001185707.1           --------------------------------------------------
XP_003312567.1           --------------------------------------------------
XP_001087735.2           --------------------------------------------------
XP_005616994.1           --------------------------------------------------
NP_001070377.1           --------------------------------------------------
NP_083678.2              --------------------------------------------------
NP_001101887.1           --------------------------------------------------
NP_001026141.1           --------------------------------------------------
XP_002666627.1           --------------------------------------------------
NP_724352.1              --------------------------------------------------
XP_313365.4              --------------------------------------------------
NP_499825.3          1   MTFNIFLTFSTISPKIFSVTSTGNRSEVHRPQAKLASNTQPTSNRTTLGR   50
XP_002935209.2           --------------------------------------------------


NP_001185707.1       1   --------MYRVTWSTFWLRFQHYTCTMSLKPRVVDFDETWNKLLTTIKA   42
XP_003312567.1       1   --------MYRVTWSTFWLRFQHYTCTMSLKPRVVDFDETWNKLLTTIKA   42
XP_001087735.2       1   --------MYKVTWPTFWLRFQHYTCTMSLKPRVVDFDETWNKLLTTIKA   42
XP_005616994.1       1   ---------------------------MSLKPRVVDFDETWNKLLTTIKA   23
NP_001070377.1       1   ---------------------------MSLKPRVVDFDETWSKLLTTIKA   23
NP_083678.2          1   ---------------------------MSLKPRVVDFDETWNKLLTTIKA   23
NP_001101887.1       1   ---------------------------MSLKPRVVDFDETWNKLLTTIKA   23
NP_001026141.1       1   ---------------------------MSLKPRVVDFDETWNKLLTTIKA   23
XP_002666627.1       1   ---------------------------MSLKPRVVDFDETWNKLLTTIRA   23
NP_724352.1          1   ---------------------------MSLKPKIVEFVDVWPRLRCIAES   23
XP_313365.4          1   ---------------------------MSLKPRRIAFDEVWKELRETVQQ   23
NP_499825.3         51   RKAISDDNFPVVEPILKKIRPPRPQVMYSLKPKVVEFDKVWVQLRPSIID   100
XP_002935209.2       1   ---------------------------MSLKPRVVDFDETWNKLLTTIKA   23


NP_001185707.1      43   VVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRH-L   91
XP_003312567.1      43   VVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRH-L   91
XP_001087735.2      43   VVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRH-L   91
XP_005616994.1      24   VVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRH-L   72
NP_001070377.1      24   VVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRH-L   72
NP_083678.2         24   VVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAETKIFLESHVRH-L   72
NP_001101887.1      24   VVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAETKIFLENHVRH-L   72
NP_001026141.1      24   VVMLDYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRH-L   72
XP_002666627.1      24   VVMLDYVERATWNDRFSDIYALCVAYPEPLGEKLYTETKVFLENHVRQ-L   72
NP_724352.1         24   VITLTKVERSVWNTSFSDVYTLCVAQPEPMADRLYGETKHFLEQHVQEML   73
XP_313365.4         24   VITLQDIKRDVWNNRFVDVYEICVAHPEPLADRLYLETKTFLENHVQTLL   73
NP_499825.3        101   IINLRPITNVQWHHKFSDVYDICVSIPTPLSERLYNEVKACIQEHVRQKR   150
XP_002935209.2      24   VVMLDYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVQQ-L   72


NP_001185707.1      92   HKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   122
XP_003312567.1      92   HKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   122
XP_001087735.2      92   HKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   122
XP_005616994.1      73   HKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   103
NP_001070377.1      73   HKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   103
NP_083678.2         73   YKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   103
NP_001101887.1      73   YKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   103
NP_001026141.1      73   HKRVLESEEQ-------------------VLVMYHRYWEEYSKGADYMDC   103
XP_002666627.1      73   FKRVLESEEK-------------------VLVMYHRYWEEYSKGAEYMDC   103
NP_724352.1         74   AKKVLIEGECSHSNGGPD-----------LLQRYYITWMEYSQGIKYLHQ   112
XP_313365.4         74   EERVLIGDSQNASNEQSAGTGSSSASPYLLLERYYDVWMEYSSGSQYLNH   123
NP_499825.3        151   QDIVDVDPDL-------------------LLQEYHKMWRVFHEGAIFIHR   181
XP_002935209.2      73   HTRVLDSAEQ-------------------VLVMYYRYWEEYSRGADYMDC   103


NP_001185707.1     123   LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVE   172
XP_003312567.1     123   LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVE   172
XP_001087735.2     123   LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVE   172
XP_005616994.1     104   LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVE   153
NP_001070377.1     104   LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVE   153
NP_083678.2        104   LYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVE   153
NP_001101887.1     104   LYRYLNTQYIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVE   153
NP_001026141.1     104   LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIE   153
XP_002666627.1     104   LYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIE   153
NP_724352.1        113   LYIYLNQQHIKKQKITDTESFYG-NLSSDAAEQMEIGELGLDIWRLYMIE   161
XP_313365.4        124   LYLYLNQQHIKKQKLNEAEAVYGCSNHGDNQEKMEIGELTLEIWNQYMIQ   173
NP_499825.3        182   LFGYLNKQFVKQKRCTDLDNFAQYAAFLQIPDVKEIGCLALEIWKEDLVK   231
XP_002935209.2     104   LYRYLNTQYIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDLWRKLMIE   153


NP_001185707.1     173   PLQAILIRMLLREIKN-----------------------------DRGGE   193
XP_003312567.1     173   PLQAILIRMLLREIKN-----------------------------DRGGE   193
XP_001087735.2     173   PLQAILIRMLLREIKN-----------------------------DRGGE   193
XP_005616994.1     154   PLQTILIRMLLREIKN-----------------------------DRGGE   174
NP_001070377.1     154   PLQAILIRMLLREIKN-----------------------------DRGGE   174
NP_083678.2        154   PLQNILIRMLLREIKN-----------------------------DRGGE   174
NP_001101887.1     154   PLQNILIRMLLREIKN-----------------------------DRGGE   174
NP_001026141.1     154   PLQAILIRMLLREIKNPSTPSSSQAEYQLKHFCFNTTGSRQDLEFDRCGE   203
XP_002666627.1     154   PLQPMLIGKLLKEIKN-----------------------------DRCGE   174
NP_724352.1        162   YLSSELVRHILEGIAA-----------------------------DRASN   182
XP_313365.4        174   RLGNELVDQILSGINA-----------------------------ERVNN   194
NP_499825.3        232   TILPQLVKLLLIAIDN-----------------------------DRKGN   252
XP_002935209.2     154   PLQDTLLRMLLKEIKR-----------------------------DRCGE   174


NP_001185707.1     194   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQEI   225
XP_003312567.1     194   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQEI   225
XP_001087735.2     194   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQEI   225
XP_005616994.1     175   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQEI   206
NP_001070377.1     175   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQEI   206
NP_083678.2        175   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQGI   206
NP_001101887.1     175   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQGI   206
NP_001026141.1     204   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKLPLKFYQEI   235
XP_002666627.1     175   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQEI   206
NP_724352.1        183   GTLDHHR-VQIINGVIHSFVEVQD------------YK-KTGSLKLYQEL   218
XP_313365.4        195   SSGQHNKSTEVIRGVIQSFVAVQE------------DR-RKGSLKLYQEL   231
NP_499825.3        253   FPHI----ANEVSGVINSFVKMEETDFDVVPAEGARYKARESTTAFYQES   298
XP_002935209.2     175   DPNQ-----KVIHGVINSFVHVEQ------------YK-KKFPLKFYQEI   206


NP_001185707.1     226   FESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHP   275
XP_003312567.1     226   FESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHP   275
XP_001087735.2     226   FESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHP   275
XP_005616994.1     207   FESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHP   256
NP_001070377.1     207   FESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHP   256
NP_083678.2        207   FVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHP   256
NP_001101887.1     207   FVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHP   256
NP_001026141.1     236   FECPFLNETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEMRCRKYLHP   285
XP_002666627.1     207   FEGPFLTKTGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEVRCRKYLHP   256
NP_724352.1        219   FEGPMLEASGAYYTDEANKLLHRCSVSEYMQEVIRILEYESRRAQKFLHV   268
XP_313365.4        232   FETRMLEESGQNFRIVASELLQVCSVSQYMERIIKKFEEEEKLAKIYLHE   281
NP_499825.3        299   FEKPLLTDTEQYYSALAQKMLTDLSCSEYMEQVIVLLEQEEMRAKKYLHE   348
XP_002935209.2     207   FELPFLAETGEYYKQEASNLLQESNCSQYMEKILGRLKDEEIRCRKYLHP   256


NP_001185707.1     276   SSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVST   325
XP_003312567.1     276   SSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVST   325
XP_001087735.2     276   SSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVST   325
XP_005616994.1     257   SSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVST   306
NP_001070377.1     257   SSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVST   306
NP_083678.2        257   SSYTKVIHECQQRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSS   306
NP_001101887.1     257   SSYTKVIHECQQRMVADHLQFLHSECHSIIRHERKNDMANMYVLLRAVSS   306
NP_001026141.1     286   SSYGKVIHECQQRMVADHLQFLHAECHNIIRQEKRNDMANMYTLLRAVSS   335
XP_002666627.1     257   SSYSKVIHECQQRMVADHLQFLHGECQNIIRQEKRDDMANMYTLLRAVSS   306
NP_724352.1        269   SSLPKLRKECEEKFINDRLGFIYSECREMVSEERRQDLRNMYVVLKPIPD   318
XP_313365.4        282   SSLPKLRKVCEEEMVTKHMNFLYSECKEMVATEKSADLRNLYILLKPVTD   331
NP_499825.3        349   SSVEKVITLCQKVMIKAHKDKLHAVCHDLITNEENKDLRNMYRLLKPIQA   398
XP_002935209.2     257   SSYNKVIHECQQRMVADHLQFLHAECHNIIRQERRSDMANMYTLLRAVSN   306


NP_001185707.1     326   GLPH-MIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLIN   374
XP_003312567.1     326   GLPH-MIQELQNHIHDEGLRATSNLTQDNMPTLFVESVLEVHGKFVQLIN   374
XP_001087735.2     326   GLPH-MIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLIN   374
XP_005616994.1     307   GLPH-MIQELQNHIQDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLIN   355
NP_001070377.1     307   GLPH-MIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLIN   355
NP_083678.2        307   GLPH-MIEELQKHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLIN   355
NP_001101887.1     307   GLPH-MIEELQRHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLIN   355
NP_001026141.1     336   GLPH-MIQELQNHIHDEGLRATSNLSQENMPTQFVESVLEVHSKLVQLIN   384
XP_002666627.1     307   GLPH-MIQELQVHIHDEGIRATINLSQENMPTLFVESVLEVHSKFVQLIN   355
NP_724352.1        319   NLKSELITTFLDHIKSEGLQTVSALKGENIHIAFVENMLKVHHKYQELIA   368
XP_313365.4        332   GLKR-LIEVFLEHIKEQGKKTISCMKGDSVHIQFVENMLDVHRKYEELIH   380
NP_499825.3        399   GLSV-MVKEFEEYVKKKGLEAVSRLTGENVPQQFVENVLRVYNKFNDMKT   447
XP_002935209.2     307   GLPH-MIQELQNHIHDEGLRAISNLSQENMPTQFVESVLEVHSKFVQLVN   355


NP_001185707.1     375   TVLNGDQHFMSALDKALTSVVNYREP-KSVCKAPELLAKYCDNLLKKSAK   423
XP_003312567.1     375   TVLNGDQHFMSALDKALTSVVNYREP-KSVCKAPELLAKYCDNLLKKSAK   423
XP_001087735.2     375   TVLNGDQHFMSALDKALTSVVNYREP-KSVCKAPELLAKYCDNLLKKSAK   423
XP_005616994.1     356   TVLNGDQHFMSALDKALTSVVNYREP-KSVCKAPELLAKYCDNLLKKSAK   404
NP_001070377.1     356   TVLNGDQHFMSALDKALTSVVNYREP-KSVCKAPELLAKYCDNLLKKSAK   404
NP_083678.2        356   TVLNGDQHFMSALDKALTSVVNYREP-KSVCKAPELLAKYCDNLLKKSAK   404
NP_001101887.1     356   TVLNGDQHFMSALDK---------------------LAKYCDNLLKKSAK   384
NP_001026141.1     385   TVLNGDQHFMSALDKALTSVVNYREP-KSICKAPELLAKYCDNLLKKSAK   433
XP_002666627.1     356   TVLNGDQHFMSALDKALTSVVNYREP-KSICKAPELLAKYCDNLLKKSAK   404
NP_724352.1        369   DVFENDSLFLSALDKACASVINRRPTERQPCRSAEYVAKYCDTLLKKSKT   418
XP_313365.4        381   TTFKSDPLFLGALDKACARIINEKHSNNQVCRSAELVAKYCDSLLKKSKT   430
NP_499825.3        448   AVFMDDGEFSSGLDKALQGVVNSKEPGQSVPKASERLARYTDGLLKKSTK   497
XP_002935209.2     356   SVLNGDQHFMSALDKALTCVVNYREP-KSVCKAPELLAKYCDNMLKKSAK   404


NP_001185707.1     424   GMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   473
XP_003312567.1     424   GMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   473
XP_001087735.2     424   GMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   473
XP_005616994.1     405   GMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   454
NP_001070377.1     405   GMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   454
NP_083678.2        405   GMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   454
NP_001101887.1     385   GMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   434
NP_001026141.1     434   GMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   483
XP_002666627.1     405   GMTENEVEDKLTSFITVFKYIDDKDVFQKIYARMLAKRLIHGLSLSMDSE   454
NP_724352.1        419   --CEAEIDQKLTNNITIFKYIEDKDVYQKFYSRLLAKRLIHEQSQSMDAE   466
XP_313365.4        431   --TEGEIDQKLTRSIIIFKYIEDKDVYQKFYSRMLAKRLIHEQSQSMDAE   478
NP_499825.3        498   GLSETDLEAKLDSAIVIFRYIEDKDIFQKFYSKMLANRLIASTSISMDAE   547
XP_002935209.2     405   GMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSE   454


NP_001185707.1     474   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLG   523
XP_003312567.1     474   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLG   523
XP_001087735.2     474   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLG   523
XP_005616994.1     455   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLG   504
NP_001070377.1     455   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLG   504
NP_083678.2        455   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLG   504
NP_001101887.1     435   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLG   484
NP_001026141.1     484   EAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTIIDLG   533
XP_002666627.1     455   EAMINKLKQACGYEFTSKLHRMYTDMSVSTDLNNKFNNFIKTQETVVDLG   504
NP_724352.1        467   EGMINRLKQACGYEFTNKLHRMFTDISVSVDLNNKFNTHLK--DSNVDLG   514
XP_313365.4        479   ELMINKLKQACGYEFTNKLHRMFTDISVSTDLNAKFSKYLN--DNKHETG   526
NP_499825.3        548   ELMINKLKQACGYEFTSKLSRMFTDIGLSQELSNNFDKHIADIKT-VQPD   596
XP_002935209.2     455   ETMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLG   504


NP_001185707.1     524   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   558
XP_003312567.1     524   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   558
XP_001087735.2     524   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   558
XP_005616994.1     505   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   539
NP_001070377.1     505   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   539
NP_083678.2        505   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   539
NP_001101887.1     485   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   519
NP_001026141.1     534   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   568
XP_002666627.1     505   ISF---QIYVLQAGAWPLT-----------HVPSS-TFAIPQELEKSVQM   539
NP_724352.1        515   INL---AIKVLQAGAWPLG-----------STQVI-PFAVPQEFEKSIKM   549
XP_313365.4        527   INF---SVKVLQAGAWPLG-----------PTQVVASFAIPQEFEKSIRL   562
NP_499825.3        597   VKFVPTQTMILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQE   646
XP_002935209.2     505   ISF---QIYVLQAGAWPLT-----------QAPSS-TFAIPQELEKSVQM   539


NP_001185707.1     559   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFN   608
XP_003312567.1     559   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFN   608
XP_001087735.2     559   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFN   608
XP_005616994.1     540   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFN   589
NP_001070377.1     540   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFN   589
NP_083678.2        540   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFN   589
NP_001101887.1     520   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFN   569
NP_001026141.1     569   FELFYSQHFSGRKLTWLHYLCTGEVKMNYLCKPYVAMVTTYQMAVLLAFN   618
XP_002666627.1     540   FELFYNQHFSGRKLTWLHYLCTGEVKMNYLSKPYVAVVTTYQMAVLLAFN   589
NP_724352.1        550   FEDYYHKLFSGRKLTWLHHMCHGELKLSHLKKSYIVTMQTYQMAIILLFE   599
XP_313365.4        563   FEEFYHINFSGRKLTWLHHLCHGEMKLSFEKRNYIVTMQTYQMAILLMFE   612
NP_499825.3        647   FEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQYVAQMYVYQMAALLCFE   696
XP_002935209.2     540   FELFYNQHFSGRKLTWLHYLCTGEVKMNYLCKPYVAMVTTYQMAVLLAFN   589


NP_001185707.1     609   NSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFS   658
XP_003312567.1     609   NSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFS   658
XP_001087735.2     609   NSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFS   658
XP_005616994.1     590   NSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDTESSFS   639
NP_001070377.1     590   NSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDVESSFS   639
NP_083678.2        590   NSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFS   639
NP_001101887.1     570   NSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFS   619
NP_001026141.1     619   NSETVSYKGLQDSTQMNEKELTKTIKSLLDVKMINHDSDK----------   658
XP_002666627.1     590   NSETVSYKELQDSTQMNEKELQKTIKSLLDVKMISHDLQKEEIEPESTFS   639
NP_724352.1        600   TCDSLSCREIQNTLQLNDETFQKHMQPIIESKLLNASSEN--LAGETRIE   647
XP_313365.4        613   NTDKYTCKELQTSLQLQQEIFQRHLQSLVEAKILLLNEEK--MNDDTEVS   660
NP_499825.3        697   RRDAILVKDIGEEIGVSGDYLLKTIRTILDVTLLTCDDQN--LTADSLVR   744
XP_002935209.2     590   NSEIVTYKELQDSTQMNEKELTKTIKSLLDVKMINHDSDKEDIDGESTFS   639


NP_001185707.1     659   LNMNFSSKRTKFKITTS-MQKDTPQ---------------------EMEQ   686
XP_003312567.1     659   LNMNFSSKRTKFKITTS-MQKDTPQ---------------------EMEQ   686
XP_001087735.2     659   LNMNFSSKRTKFKITTS-MQKDTPQ---------------------EMEQ   686
XP_005616994.1     640   LNMNFSSKRTKFKITTS-MQKDTPQ---------------------EMEQ   667
NP_001070377.1     640   LNMNFSSKRTKFKITTS-MQKDTPQ---------------------EMEQ   667
NP_083678.2        640   LNMSFSSKRTKFKITTS-MQKDTPQ---------------------ELEQ   667
NP_001101887.1     620   LNMSFSSKRTKFKITTS-MQKDTPQ---------------------ELEQ   647
NP_001026141.1           --------------------------------------------------
XP_002666627.1     640   LIMSFTSKRTKFKITTS-MQKDTPQ---------------------ELEQ   667
NP_724352.1        648   LNLDYTNKRTKFKISSA-LQKETPQ---------------------EVEH   675
XP_313365.4        661   INVNYSNKRTKFKITTN-LQKETPQ---------------------EVEH   688
NP_499825.3        745   LNMSMTSKRMKFRLQAPQVNKAVEK---------------------EQEA   773
XP_002935209.2     640   LNMNFSSKRTKFKITTP-MQKDTPQGAQPTCAEEAMLWRGERRFSLEVEQ   688


NP_001185707.1     687   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISM   736
XP_003312567.1     687   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISM   736
XP_001087735.2     687   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISM   736
XP_005616994.1     668   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISM   717
NP_001070377.1     668   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISM   717
NP_083678.2        668   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISM   717
NP_001101887.1     648   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISM   697
NP_001026141.1     659   ---VCSNDIKMFSVLSVVFLLFVEVFLIQKNLF-----------------   688
XP_002666627.1     668   TRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVINQSKARFNPSISM   717
NP_724352.1        676   TINSVDEDRKLFLQAAIVRIMKARKVLKHNALIQEVLSLSKVSFTPNIAM   725
XP_313365.4        689   TMNAVDEDRKMYLQAAIVRIMKSRKVLRHNTLIQEILSQSKVSFAPNVSM   738
NP_499825.3        774   VANTVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPF   823
XP_002935209.2     689   TRSAVDEDRKMYLQAAIVRIMKARKILRHNALIQEVISQSRARFNPSISM   738


NP_001185707.1     737   IKKCIEVLIDKQYIERSQASADEYSYVA   764
XP_003312567.1     737   IKKCIEVLIDKQYIERSQASADEYSYVA   764
XP_001087735.2     737   IKKCIEVLIDKQYIERSQASADEYSYVA   764
XP_005616994.1     718   IKKCIEVLIDKQYIERSQASADEYSYVA   745
NP_001070377.1     718   IKKCIEVLIDKQYIERSQASADEYSYVA   745
NP_083678.2        718   IKKCIEVLIDKQYIERSQASADEYSYVA   745
NP_001101887.1     698   IKKCIEVLIDKQYIERSQASADEYSYVA   725
NP_001026141.1           ----------------------------
XP_002666627.1     718   IKKCIEVLIDKQYIERSQSSADEYSYVA   745
NP_724352.1        726   IKKCVESLIDKQYIERTANSGDEYSYMA   753
XP_313365.4        739   IKKCIESLIDKQYIERTPNSGDEYSYVA   766
NP_499825.3        824   IKKSIEDLIEKMYIQRTDQN-DEYQYLA   850
XP_002935209.2     739   IKKCIEVLIDKQYIERSQASADEYSYVA   766


Protein Acc. Gene Organism
NP_001185707.1 CUL2 H.sapiens
XP_003312567.1 CUL2 P.troglodytes
XP_001087735.2 CUL2 M.mulatta
XP_005616994.1 CUL2 C.lupus
NP_001070377.1 CUL2 B.taurus
NP_083678.2 Cul2 M.musculus
NP_001101887.1 Cul2 R.norvegicus
NP_001026141.1 CUL2 G.gallus
XP_002666627.1 cul2 D.rerio
NP_724352.1 Cul-2 D.melanogaster
XP_313365.4 AgaP_AGAP003605 A.gambiae
NP_499825.3 cul-2 C.elegans
XP_002935209.2 cul2 X.tropicalis


Support Center