Display Settings:

Format

Send to:

Choose Destination
HomoloGene:22858. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_055842.2          1   ---MDASLEK-IADP----------------------------------T   12
XP_510837.3              --------------------------------------------------
XP_001109439.2           --------------------------------------------------
XP_547116.2          1   ---MDASLEK-IADP----------------------------------T   12
NP_001095329.1       1   ---MDASLEKKIADP----------------------------------T   13
NP_444411.2          1   ---MDASLEK-IADP----------------------------------T   12
NP_001128433.1       1   ---MDASLEK-IADP----------------------------------T   12
XP_414728.2          1   ---MDATLEK-VVDP----------------------------------T   12
NP_001004552.2       1   ---MEKPPVK-MMDP----------------------------------T   12
NP_728413.1          1   MSAAGRSVDDPGQSPLVDQEPDPGQSTPAVA---------EIAASSIRSG   41
XP_316831.5          1   ---MKEPEVDGGTGP-----TDPGQEEPSMATREVQTQQTEIAASIVRSS   42
NP_001123108.1       1   ---MATSAEMSG-------------------------------------T   10
XP_002937727.1       1   ---MQKHIPQ-MVDP----------------------------------T   12


NP_055842.2         13   LAEMGKNLKEAVKMLEDSQR----------------------------RT   34
XP_510837.3          1   ---MGKNLKEAVKMLEDSQT----------------------------RT   19
XP_001109439.2       1   ---MGKNLKEAMKMLEDSQR----------------------------RT   19
XP_547116.2         13   LAEMGKNLKEAMKMLEDSQR----------------------------RT   34
NP_001095329.1      14   LAEMGKNLKEAMKMLEDSQR----------------------------RT   35
NP_444411.2         13   LAEMGKNLKEAMRMLEKSPR----------------------------RT   34
NP_001128433.1      13   LAEMGKNLKEAMRMLENSPR----------------------------RI   34
XP_414728.2         13   LAEMGKNLNEAMKMLEDSQR----------------------------KV   34
NP_001004552.2      13   LAEMGNHLSDAMKILESGKL----------------------------ET   34
NP_728413.1         42   LAELELRSSQVLQRLENVKVSTTPESPNPV------------------EN   73
XP_316831.5         43   LAEIETQASGMLNHLEYVRAGQKQAQPQPQPQPQPQPSQPPTSQQRRDSS   92
NP_001123108.1      11   VQQIESIIQTIESKIDVSSQQHSPASNSSSTKSE--------------DS   46
XP_002937727.1      13   LAEMGKNLDEAMKILEDNQR----------------------------PS   34


NP_055842.2         35   EEENG-KKLISGDI---PGPL------QGSGQDMVSILQLVQNLMHGDE-   73
XP_510837.3         20   EEENG-KKLVSGDI---PGPL------QGSGQDMVSILQLVQNLMHGDE-   58
XP_001109439.2      20   EEENG-KKLISGDI---PGPL------QGSGQDMVSILQLVQNLMHGDE-   58
XP_547116.2         35   EEENG-KKLVSGDI---PGPL------QGSGQDMVSILQLVQNLMHGDE-   73
NP_001095329.1      36   EEENG-KKLLSGDI---PGPL------QGSGQDMVSILQLVQNLMHGDE-   74
NP_444411.2         35   EEENG-KKPVSEDI---PGPL------QGSGQDMVSILQLVQNLMHGDE-   73
NP_001128433.1      35   EEESG-KKPVPEDI---PGPL------QGSGQDMVSILQLVQNLMHGDE-   73
XP_414728.2         35   EEENE-KKYARKDI---PGPL------QGSGQDMVSILQLVQNLMHGEE-   73
NP_001004552.2      35   EQGQEGRKMSWKEI---PGPL------QGDGQDVVSILQLVQNLMHGDD-   74
NP_728413.1         74   EEEAG-ERVTSEDL--LPAKH------RVPSDILKSLEQLVSYTDSDDD-   113
XP_316831.5         93   EESSG-SASAASGVYGLELAR------KPHAEVLASLEHLLATLLPEED-   134
NP_001123108.1      47   GLDDGPKKSVTSAK---PISRKSSRMSQSSGVSLPPVLEQLEHMIISDDW   93
XP_002937727.1      35   EEERDGKKHSRKDI---PGPL------QGSGQNMVSILQLVQNLMHDDE-   74


NP_055842.2         74   ---------------DEEP-QSPRIQNIGEQGHMALLGHSLGAYISTLDK   107
XP_510837.3         59   ---------------DEEP-QSPRIQNIGEQGHMALLGHSLGAYISTLDK   92
XP_001109439.2      59   ---------------DEEP-QSPRIQNIGEQGHMALLGHSLGAYISTLDK   92
XP_547116.2         74   ---------------DEEP-QSTRIQNIGEQGHIALLGHSLGAYISTLDK   107
NP_001095329.1      75   ---------------DEQP-QSTRIQNIGEQGHISLLGHSLGAYISTLDK   108
NP_444411.2         74   ---------------DEEP-QSTRIQNIGEQGHMALLGHSLGAYISTLDK   107
NP_001128433.1      74   ---------------DEEP-QSTRIQNIGEQGHMALLGHSLGAYISTLDK   107
XP_414728.2         74   ---------------EEESSQAYRLQNVGEQGHMALLGHSLAAYISVLDK   108
NP_001004552.2      75   ---------------EE---QGHRMQFVGEQGHMALLGHSLAAYISVLER   106
NP_728413.1        114   --------------------PEFPLPALDDVSHLALISHSIVAYLSHLDR   143
XP_316831.5        135   ---------------GGTDQQEFVLPPLDEASHLAILQHSTAAYLGALER   169
NP_001123108.1      94   LGSESTSPSGLKQHAQVAKTRSREGQKLSELGRTLVTSASLKSYIDLLSS   143
XP_002937727.1      75   ---------------EEESLSFRRIQNVGEQGHMALLGHSLAAYISVLDR   109


NP_055842.2        108   EKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEE-------REGLAKIC   150
XP_510837.3         93   EKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEE-------REGLAKIC   135
XP_001109439.2      93   EKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEE-------REGLAKIC   135
XP_547116.2        108   EKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEE-------REGLAKIC   150
NP_001095329.1     109   EKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEE-------REGLAKIC   151
NP_444411.2        108   EKLRKLTTRILSDTTLWLRRIFRYENGCAYFHEEE-------REGLAKIC   150
NP_001128433.1     108   EKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEKE-------REGLAKIC   150
XP_414728.2        109   ERLRKLTTRILSDTTLWLCRLFRYENGSAYYHEDD-------REGLLKIC   151
NP_001004552.2     107   ERLRKLTTRILSDTTLWLCRLFRYENGSAYFHEDD-------REGLLKVC   149
NP_728413.1        144   QQLLRVTNSISGDATRWLGTLFHFAHPASSFHADN-------ADAVLRTV   186
XP_316831.5        170   HQLARVVSRLATDAARWLGGLFKFADCHTNYCRDE-------AECTLQAI   212
NP_001123108.1     144   HHRQSIASWLYGNVNHVFSNLFRFADSQIYCSDPEATISLSIRNGIGHAV   193
XP_002937727.1     110   DRLRKLTTRILSDTTLWLCRLFRYDHGSAYYHEDD-------REGLLKVC   152


NP_055842.2        151   RLAIHSRYE-DFVVDGFNVLYNK-KPVIYLSAAARPGLGQYLCNQLGLP-   197
XP_510837.3        136   RLAIHSRYE-DFVVDGFNVLYNK-KPVIYLSAAARPGLGQYLCNQLGLP-   182
XP_001109439.2     136   RLAIHSRYE-DFVVDGFNVLYNK-KPVIYLSAAARPGLGQYLCNQLGLP-   182
XP_547116.2        151   RLAIHSRYE-DFVVDGFNVLYNK-KPVIYLSAAARPGLGQYLCNQLGLP-   197
NP_001095329.1     152   RLAIHSRYE-DFVVDGFNVLYNR-KPVLYLSAAARPGLGQYLCNQLGLP-   198
NP_444411.2        151   RLAIHSRYE-DFVVDGFNVLYNK-KPVIYLSAAARPGLGQYLCNQLGLP-   197
NP_001128433.1     151   RLAIHSRYE-DFVVDGFNVLYNK-KPIIYLSAAARPGLGPYLCNQLGLP-   197
XP_414728.2        152   RLVIHTCYE-DYTVEGFNVLCTK-QPVIYISSAARTGLGQALCNQLGLP-   198
NP_001004552.2     150   RLVMNTHYE-DFTTEGFTALSSK-HPVIYQSAACRPGLGQHLCSQLGLP-   196
NP_728413.1        187   RLAIVARCP-GYLEGGIPALA---QPTFYISENTTPMRLHYACRQLGIP-   231
XP_316831.5        213   RLALIQQQG-EARADARPPTA---AHTIYLADLAQLYTVQHACRYLGLP-   257
NP_001123108.1     194   KLALKSSYGTDHSTKGWRAFAEQGAPVVYVSPALHMDLSSYLASEFGIAD   243
XP_002937727.1     153   RLVIHSRYE-DYTTDGFNALYNK-QPVIYISAASRPGLGQSICNQLGLP-   199


NP_055842.2        198   FPCLCRVPCNTV----FGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAG   243
XP_510837.3        183   FPCLCRVPCNTM----FGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAG   228
XP_001109439.2     183   FPCLCRVPCNTM----FGSQHQMDVAFLEKMIKDDIERGRLPLLLVANAG   228
XP_547116.2        198   FPCLCRVPCNTM----FGSQHQMDVAFLEKLIKDDIERGKLPLLLVANAG   243
NP_001095329.1     199   FPCLCRVPCNTV----FGSQHQMDVAFLEKLIKDDIERGKLPLLLVANAG   244
NP_444411.2        198   FPCLCRVPCNTM----FGSQHQMDVAFLEKLIKDDVERGRLPLLLVANAG   243
NP_001128433.1     198   FPCLCRVPCNTM----FGSQHQMDVAFLEKLIKDDVERGRLPLLLVANAG   243
XP_414728.2        199   LSCMCRVPCNTM----FGSQHQMDVALLDRLIKDDVECGKLPLLLVANAG   244
NP_001004552.2     197   LSCLCVVPCNTM----FGSLHQMDVALLDKLVKDDRDSGKLPLLLIANAG   242
NP_728413.1        232   LEAIKVIPEHSQ-------SGTMDVTLLQKQIQQDVGNNRTPLLVVADIG   274
XP_316831.5        258   LSCIRVVPCQRAEDAPDGCGGRMDLQQLDSMLTMDEAAGRQPLLLFATVG   307
NP_001123108.1     244   VTILPKLDSDRG-----EIEGRIDHHQFEKILDEDLAAGKKPLILIGVVG   288
XP_002937727.1     200   LSCLCRVPCNTM----FGSQHQMDVALLDRLIKDDIQSGKCPLLLVANAG   245


NP_055842.2        244   TAAVGHTDKIGRLKELCEQY-GIWLHVEGVNLATLALGYVSSSVLAA-AK   291
XP_510837.3        229   TAAVGHTDKIGRLKELCEQY-GIWLHVEGVNLATLALGYVSSSVLAA-AK   276
XP_001109439.2     229   TAAVGHTDKIGRLKELCEQY-GIWLHVEGVNLATLALGYVSSSVLAA-TK   276
XP_547116.2        244   TAAVGHTDKIGRLKELCEQY-GIWLHVEGVNLATLALGYVSSSVLAA-TK   291
NP_001095329.1     245   TAAVGHTDKIGRLKEVCEQY-GIWLHVEGVNLATLALGYVSSSVLAA-TK   292
NP_444411.2        244   TAAVGHTDKIGRLKELCEQY-GIWLHVEGVNLATLALGYVSSSVLAA-TK   291
NP_001128433.1     244   TAAVGHTDKIGRLKELCEQY-GIWLHVEGVNLATLALGYVSSSVLAA-TK   291
XP_414728.2        245   TPGAGHTDKLGRLKELCEQY-NMWLHVEGVNLATLALGYVSSSVLAA-TK   292
NP_001004552.2     243   TPGAGHTDKLSRLKELCVQY-NMWLHVEGVNLATLVLGQVSSTVTAA-TK   290
NP_728413.1        275   ASLCGYVDNLLRLRDVCKAH-NMWLHASGHGLAAL-VCAQNQGHVEE-VL   321
XP_316831.5        308   SPLTGVSDDLLALSTICAAQ-RMWLHCQGLGLAGLALTATWMGKSKR-MP   355
NP_001123108.1     289   TTIMGQNDMISKILEIREKKAKFWLHITGQAIAALTFREPNNILVHVLSQ   338
XP_002937727.1     246   TPGAGHTDKLGRLKELCDQY-NIWLHVEGVNLATLALGYVSSSVLAA-TK   293


NP_055842.2        292   CDSMTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNK-PTDKLRALP   340
XP_510837.3        277   CDSMTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNK-PTDKLRALP   325
XP_001109439.2     277   CDSMTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNK-PADKLRALP   325
XP_547116.2        292   CDSMTLTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNK-PADKLRALP   340
NP_001095329.1     293   CDSMTLTPGPWLGLPAVPAVTLYKHDDPALTLVSGLTSNK-PADKLRALP   341
NP_444411.2        292   CDSMTLTPGLWLGLPAVPAVTLYKHDDPALTLVAGLTSNK-PADKLRALP   340
NP_001128433.1     292   CDSMTLTPGLWLGLPAVPAVTLYKHDDPALTLIAGLTSNK-PADKLRALP   340
XP_414728.2        293   CDSMTLTLGSWLGLPAVPAVTLYKHEDPSLSLVAGLTSSQ-PVEKLRALP   341
NP_001004552.2     291   CDSMTLTPGPWLGLPAVPAVTLYRHEDPALSLAAGLTSSQ-PVEKLRALP   339
NP_728413.1        322   -HSMALNLGSWLGVPSLPIVLLHRP--LQNSALSAFESDPILSRRLNALS   368
XP_316831.5        356   -NSFTLSLNSWLGLTGVPSVLVHKPSTITAKPSTVFDSDPILSNRVSCLS   404
NP_001123108.1     339   VDSMTVPIALWLGIPSAPVVTLHRP-------VEGYKAS--YREKLDTLP   379
XP_002937727.1     294   CDSMTLTLGPWLGLPAVPAVTLYRHEDPSLSLAAGLTSSQ-PVEKLRALP   342


NP_055842.2        341   LWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVED-------   383
XP_510837.3        326   LWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVED-------   368
XP_001109439.2     326   LWLSLQYLGLDGIVERIKHACQLSQRLQESLKKVNYIKILVED-------   368
XP_547116.2        341   LWLSLQYLGLDGIVERIKHACQLSQRLQESLKKVNHIKILVED-------   383
NP_001095329.1     342   LWLSLQYLGLDGIVERIKHACQLSQRLQESLKKVNHIKILVED-------   384
NP_444411.2        341   LWLSLQYLGLDGIVERIKHACHLSQRLQESLKKVDHIKILVED-------   383
NP_001128433.1     341   LWLSLQYLGLDGIVGRIKHACQLSQRLQESLKKVDHIKILVED-------   383
XP_414728.2        342   LWLSLQYLGHDGIVERIKHASQLSQRLLENLKNLDFIKTSVED-------   384
NP_001004552.2     340   LWLSLQYLGHDGIVERIKHASQLSQQLLEHLKTLASIKTSVED-------   382
NP_728413.1        369   LWTSLQALGRKAIAERLHVAFQTCSILFEIASKCEGIRVLSHTPGAQTGA   418
XP_316831.5        405   VWAVLQALGADTVIERIFSAFDSCQALGKILLQFEGINVLSKVAAHDSSD   454
NP_001123108.1     380   WWVASSYLSGKKIVDMIENAFLLSKVMLKGLSAIPEVEMIGVDNPVELAN   429
XP_002937727.1     343   LWLSLQYLGHSGIVERIKHASQLSQKLLESLKNLSSVKTSVEN-------   385


NP_055842.2        384   ----------------ELSSP-VVVFRFF--------------------Q   396
XP_510837.3        369   ----------------ELSSP-VVVFRFF--------------------Q   381
XP_001109439.2     369   ----------------ELSSP-VVVFRFF--------------------Q   381
XP_547116.2        384   ----------------ELSSP-VVVFRFF--------------------Q   396
NP_001095329.1     385   ----------------ELSSP-VVVFRFF--------------------Q   397
NP_444411.2        384   ----------------ELSSP-VVVFRFF--------------------Q   396
NP_001128433.1     384   ----------------ELSSP-VVVFRFF--------------------Q   396
XP_414728.2        385   ----------------ELSSP-VVVFKFF--------------------Q   397
NP_001004552.2     383   ----------------ELNSP-VVVFRFS--------------------H   395
NP_728413.1        419   SLSDVIQSPFDVQALFDAAAP-VVAYQFDGSTTIP--------------L   453
XP_316831.5        455   QYRYYLEGAANYNMLFDHSIP-VLLFQFDGHTDTRNRTESESDQAPAKVT   503
NP_001123108.1     430   RVYKN-----------KFTPPTVLIFKYN--------------------Y   448
XP_002937727.1     386   ----------------DGSSP-VVVFRFV--------------------Y   398


NP_055842.2        397   ELPGSDPVFKAVPVPNMTPSGVG--------RERHSCDALNRWLGEQLKQ   438
XP_510837.3        382   ELPGSDPVFKAVPVPNMTPSAVG--------RERHSCDALNRWLGEQLKQ   423
XP_001109439.2     382   ELPDSDPVFKAVPVPTMTASAVG--------RERHSCDALNRWLGEQLKQ   423
XP_547116.2        397   ELPGSDPVLKAIPVPSMAPSAVG--------RERHSCDALNRWLGEQLKQ   438
NP_001095329.1     398   ELPGSDPGLNAIPAPSAAASAVG--------RERHSCDALNRWLGEQLKQ   439
NP_444411.2        397   ELPASDSAFKAVPVSNIAPAAVG--------RERHSCDALNRWLGEQLKQ   438
NP_001128433.1     397   ELPTLDPAFKVAAVSNIAAAAVG--------RERHSCDALNRWLGEQLKQ   438
XP_414728.2        398   KYLNRDLTPHAAQTSAIQHPVIS--------NEGHIYDTFNQWLGDQLAQ   439
NP_001004552.2     396   ENSAPSSG------GSVEGSYAG---------ERDILDAFNRWLGDQLAE   430
NP_728413.1        454   GGSGSSAAAAAAERETAEGLKPL-----EKINNASYFDRLNSWLGQILQR   498
XP_316831.5        504   TTTSTTAAPATSPPEATDEPKPAYQTVEKNPSNAQYYDRLNSWLGQILLR   553
NP_001123108.1     449   VSIKNAIQHHKDLIQNNDDHDAIAIAEKTLQDELEYGDYLNAWLRDGLLP   498
XP_002937727.1     399   EGCKSD--------STLNLSTIE--------RDS---DALNQWLGDQLAA   429


NP_055842.2        439   LVPASGLTVMDL-EAEGTCLRFSPLMTAAVLGT-----RGEDVDQLVACI   482
XP_510837.3        424   LVPAGGLTVMDL-EAEGTCLRFSPLMTAAVLGT-----RGEDVDQLVACI   467
XP_001109439.2     424   LVPASGLTVMDL-EAEGTCVRFSPLMTAAVLGT-----RGEDVDQLVACI   467
XP_547116.2        439   LVPASGLTVMDL-EVEGVCIRFSPLMTAAVLGT-----RGEDVDQLVACI   482
NP_001095329.1     440   LVPMSGLTVMDL-EVEGTCVRFSPLMTAAVLGT-----RGEDVDQLVACV   483
NP_444411.2        439   LVPQCGLTVIDL-EVDGTCVRFSPLMTAEGLGT-----RGEDVDQLITCI   482
NP_001128433.1     439   LVPQCGLTVMDL-DIDGTCVRFSPLMTAEALGT-----RGEDVDQLITCI   482
XP_414728.2        440   MVPASGIDVVEL-EDEGTCVRFSPLMTSAVLGT-----EIQDVDQLVDCL   483
NP_001004552.2     431   QVPLSGVDVVEL-EDEGTCVRFSPLMTAAALGT-----QENDVAALVEKL   474
NP_728413.1        499   DCPNFDFEVIEH-PTHGSCIRYCPLE--LGLGEQPP--SSENLESFAQSL   543
XP_316831.5        554   DCGQLSLEMIEH-EQHGICIRYCPFV--PGYGEQVPRLTPDQLLTFAGCI   600
NP_001123108.1     499   ESLPLGIDTIELGGNYGIAFRFCPLEHAATYSS-----HIDHVQRFVRKL   543
XP_002937727.1     430   LVPLCGVDIVEL-EDEGTCVRFNPLMTTAVLGT-----TAEDVEQLVACL   473


NP_055842.2        483   ESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRYEH----A   528
XP_510837.3        468   ESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWPGIGVVRYEH----A   513
XP_001109439.2     468   ESKLPVLSSTLQLREEFKQEVEATAGLLYVDDPNWPGIGVVRYEH----A   513
XP_547116.2        483   QSQLPILTCTLQLREEFKQEVTAAAGLLHVDDPNWPGIGVVRYEH----A   528
NP_001095329.1     484   QSKLPVLTCTLQLREEFKQEVEATAGLLYVDDPNWPGIGVVRYEH----A   529
NP_444411.2        483   QSKLPVLTCTLQLREEFKQEVEGTAGLLYVDDPNWPGIGVVRYEH----A   528
NP_001128433.1     483   QSKLPVLTCTLQLREEFKKEVEGTAGLLYVDDPNWPGIGVVRYEH----A   528
XP_414728.2        484   KMKIPVLTSTLQLREEFEQEVRRTVGLLYIEDLSWPGLGVVRYSY----H   529
NP_001004552.2     475   AEMIPLLCCTLRLRQDFRDEVLQQASLSYIEDLNWPGLGVVRFEP----R   520
NP_728413.1        544   EAHVDILRATIKHKARFIHLVECSDVLRLVPLPEWAGMGGVRFVP----E   589
XP_316831.5        601   ETQIEILHSTIRHRARFQQLVAASGVLRLIELHDWAGLGGVYYVP----E   646
NP_001123108.1     544   TDIMRIVESTVVSKLKFSELKDDFPSLVLLPIRNWAGIGAVCYIPSIVKE   593
XP_002937727.1     474   RMKIPVLQNTLKLKEEFRQEVERIAGLSYINDYSWAGLGVLRYEQ----F   519


NP_055842.2        529   N-DDKSSLKSDPEGENIHAGLLKKLNELESDLTFKIGPEYKSMKSCLYVG   577
XP_510837.3        514   N-DDKSSLKSDPEGEKIHAGLLKKLNELESDLTFKIGPEYKSMKSCLYVG   562
XP_001109439.2     514   N-DDKSSLKSDPEGEKIHAGLLKKLNELESDLTFKIGPEYKSMKSCLYVG   562
XP_547116.2        529   N-DDKSSLKLDPEGEKIHAGLLKKLNELESDLTFKMGPEYKSMKSCIYVG   577
NP_001095329.1     530   N-DDKSSLKLDPEGEKIHAGLLKKLNELESDLTFKMGPEYKSMKSCIYIG   578
NP_444411.2        529   N-DDDTSLKSDPEGEKIHTGLLKKLNELESDLTFKIGPEYKSMKSCIYIG   577
NP_001128433.1     529   N-DDNTSLQSDPEGEKIHTGLLKKLNELESDLTFKMGPEYKSMKSCIYIG   577
XP_414728.2        530   S-DEKNNDNQEKELEKINTELLKKLNELESDLTFSLGPEFGGQKNCVYIG   578
NP_001004552.2     521   T-TDLDEDKRQDRVEKINSDLLKKLMELDTDLNFSGGPEFSEEKNCIFIG   569
NP_728413.1        590   GWESLLTDQAKTELNKLNIDLVEALKS--TDNAFSLGEGTDGL-ICVRFG   636
XP_316831.5        647   GWETLLTDQAKGELNKLNTALVEALQA--TDSAFSHAESSDGL-ICVRFG   693
NP_001123108.1     594   TNPEDWNDIQKQQISHLNLELVHQLKS--VDAAFSSGDCTRYGVSCVKFG   641
XP_002937727.1     520   N-EEQDSDKREADLEKITVALLKKLNELETDLPFSSGPEFGAEKNCIYIG   568


NP_055842.2        578   MASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKA   627
XP_510837.3        563   MASDDVDAAELVETIVATAREIEENSRLLENMTEVVRKGIQEAQVELQKA   612
XP_001109439.2     563   MASEDMDVAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKA   612
XP_547116.2        578   MASDDVDISELVETIAVTAREIEENSRLLENMTEVVRKGIQEAQVQLQKA   627
NP_001095329.1     579   MASDDIDISELVETIAVTAREIEEDSRLLENMTEVVRKGIQEAQVQLQKA   628
NP_444411.2        578   MASDDVDVSELVETIAVTAREIEENSRLLENMTEVVRKGIQEAQVQLQKA   627
NP_001128433.1     578   MASDDVDVSELVETIAITAREIEENSRLLENMTEVVRKGIQEAQVQLQKA   627
XP_414728.2        579   MVTEDLDVSELVETIAATGREIEENSRLLENMTEVVRKGIQEAQLQLQKA   628
NP_001004552.2     570   IATEDLDVAELVETIMSLGRDIEESGKLFENMTEVVRKGIQEAELQLQKA   619
NP_728413.1        637   MVTHETEVEELLDLVVTVGKSVQENSRVLDTMSEIVKKGIEAVTADLQRE   686
XP_316831.5        694   MVTSETDVEELLELVVQTARVVQENSKILDTMSEILKKGIEAATIDLQRE   743
NP_001123108.1     642   MLSDVKDLHNLVEMVAQKGKEIENSQQYLDSLAHLIRQGIEAANEALRKE   691
XP_002937727.1     569   MASEDLDVPELVETITAMGREIEENTRLLENMTEVVRKGILEAEVQLYKA   618


NP_055842.2        628   SEERLLEEGVLRQIPVVGSVLNWFSPV--QA-LQKGRTFNLTAGSLESTE   674
XP_510837.3        613   SEERLLEEGVLRQIPVVGSVLNWFSPV--QA-LQKGRTFNLTAGSLESTE   659
XP_001109439.2     613   NEERLLEEGVLRQIPVVGSVLNWFSPV--QA-LQKGRTFNLTAGSLESTE   659
XP_547116.2        628   NEERLLEEGVLRQIPVVGSVLNWFSPV--QA-SQKGRTFNLTAGSLESTE   674
NP_001095329.1     629   NEERLLEEGVLRQIPVVGSVLNWFSPV--QA-SQKGRTFNLTAGSLESTE   675
NP_444411.2        628   NEERLLEEGVLRQIPVVGSVLNWFSPV--QA-SQKGRSFNLTAGSLESTE   674
NP_001128433.1     628   NEERLLEEGVLRQIPVVGSVLNWFSPV--QA-SQKGRSFNLTAGSLESTE   674
XP_414728.2        629   NEERLLEEGLLRQIPVVGSVLNWFSPF--QA-SPKGRTFNLTAGSLESTE   675
NP_001004552.2     620   NEEKLMEEGVLRQIPLVSSVLNWFSPV--QA-SVKGRTFNLAEGCLDSTE   666
NP_728413.1        687   SEEKLWQEGILRHVPVVGRVFNWWSPPAKES-GIKGRSLNLTQGVVESTE   735
XP_316831.5        744   AEEKLWQEGILRQVPLVGRVVNWWSPPAKET-GMKGRSLNLTQGVVESTE   792
NP_001123108.1     692   NDQRLQNEGMMRQLPIMGSLVNWWSPLTPESQNIRGRAFNLKTGEMQETD   741
XP_002937727.1     619   NEERLLEEGVLRQIPLVGSMLNWFSPV--QT-TPKGRTFNLTAGSLETTE   665


NP_055842.2        675   PIYVYKAQGAGVT--------LPPTPSGSRTKQRLPGQKPFK--RSLRGS   714
XP_510837.3        660   PIYVYKAQGAGVT--------LPPTPSGSRTKQRLPGQKPFK--RSLRGS   699
XP_001109439.2     660   PIYVYKAQGAGVT--------PPPTPSGSRTKQRLPGQKPFK--RSLRGS   699
XP_547116.2        675   HTYVYKVQGTGVT--------PPQTPSGTRTKQRLPGQKPFK--RSLRGS   714
NP_001095329.1     676   HTYVYKVQGSGVT--------PPQTPTGTRTKQRLPGQKPFK--RSLRGS   715
NP_444411.2        675   YTYVHKVQGTGVT--------PPPTPLGTRSKQRLPGQKPFK--RSLRGS   714
NP_001128433.1     675   YTYVYKVQGTGVT--------PPPTPSGTRSKQRLPGQKPFK--RSLRSS   714
XP_414728.2        676   STYVSKAQGTGIT--------PPPTPTSSLTKQKHLGQKIFK--RSLRNS   715
NP_001004552.2     667   PVYSIKAQMRKED--------SPDSPKAN--TRRFPGQKLFR--RPGAGS   704
NP_728413.1        736   NIYKYHMQMTGATAHQLPANRSPPTPMVQTPVVAPALPPVFPTVEPVPGN   785
XP_316831.5        793   NIYKYHMQMTPKTSHQLPGNKAPPAPLVQKAINADPDDRSVQHSRNASSS   842
NP_001123108.1     742   VLFKSKKNMDA----------TPPITKNETPQ------------------   763
XP_002937727.1     666   TTYISKAQTTGLT--------PPSTPTSAHAK-RQPGQKLFK--RLSRNS   704


NP_055842.2        715   DALSETSSV-SHIEDLEKVER----LSSGPEQITLEASSTEG--------   751
XP_510837.3        700   DALSETSSV-SHIEDLEKVER----LSGGLEQITLEASSTEG--------   736
XP_001109439.2     700   DALSETSSA-SHIEDLEKVER----LSGGPEQITLEASSTEG--------   736
XP_547116.2        715   DALSETSSV-SHVEDLEKMEH----LSSGPEQDALETTGPEP--------   751
NP_001095329.1     716   DAISETSSV-GHIEDLEKMEQ----SSGG--QEASEANSHER--------   750
NP_444411.2        715   DAVSETSSV-SHIEDLEKVEQ----LSSGLEHDNLEAHSPEQ--------   751
NP_001128433.1     715   DAVSETSSV-SHIEDLEKVEQ----LPSGLEHDNLEAQCPEQ--------   751
XP_414728.2        716   DAFSETSSV-SHCDDMEKMDQRSPTLSPGQEQRPLEPEKTEL--------   756
NP_001004552.2     705   DSISETSSV-SQLEE------------SFRETLHSQAADEAE--------   733
NP_728413.1        786   GNGSGASEG--------------TPVQSGEASGSMPAASGAA--------   813
XP_316831.5        843   SELSGAGAGRTSLPALAKSPHSPTATQPQQQPTPPPPSSAAS--------   884
NP_001123108.1           --------------------------------------------------
XP_002937727.1     705   DAMSETSSI-SHLEEVESLEA-----LPMPDTQQFDSTADELSATAENSA   748


NP_055842.2        752   HPGAPSPQHTDQTEAFQKGVPHPEDDHSQV-EGPESLR--   788
XP_510837.3        737   HPGAPSPQHTDQTEAFQKGVPHPEDDHPQV-EGPESLR--   773
XP_001109439.2     737   HPGAPSPQHASRSEAFQKGAPHPEDDHPQV-EGAESLR--   773
XP_547116.2        752   PPGAPSPQEAEPLGAPQSRVQRPEDDRPQV-EDAESLR--   788
NP_001095329.1     751   HPEAPAPPEAEPPGALQDGAQGLQDDRPQV-EEPESLR--   787
NP_444411.2        752   PPRATDLT-ARQTEALQNQAQHQEDDHSQV-EELERLR--   787
NP_001128433.1     752   PCRAADPV-ARQTEALQD----EEDDHSQMGTRVRRLKV-   785
XP_414728.2        757   LPKVVPQATNKDTEDIQS--SKSLNDCTSV-EEQGSQR--   791
NP_001004552.2     734   VPQERPAHILEETAIADQRVPEGQEA-----ESVETIR--   766
NP_728413.1        814   -PSAAPTQNHVDHARTVSQSSAASSTVPELVAASSAINNN   852
XP_316831.5        885   -LSVPPATKPVSPTGTSRAAVEPQPTTPTPDGGATAEP--   921
NP_001123108.1     764   IPHEPFATKIDEEPTSESETAVTEEAVSSA-EEAKPVESS   802
XP_002937727.1     749   IPSVVPTETSSEAS--QE--PIILNANTA---ESDSLR--   779


Protein Acc. Gene Organism
NP_055842.2 PDXDC1 H.sapiens
XP_510837.3 PDXDC1 P.troglodytes
XP_001109439.2 PDXDC1 M.mulatta
XP_547116.2 PDXDC1 C.lupus
NP_001095329.1 PDXDC1 B.taurus
NP_444411.2 Pdxdc1 M.musculus
NP_001128433.1 Pdxdc1 R.norvegicus
XP_414728.2 PDXDC1 G.gallus
NP_001004552.2 pdxdc1 D.rerio
NP_728413.1 CG1486 D.melanogaster
XP_316831.5 AgaP_AGAP000861 A.gambiae
NP_001123108.1 C14H10.3 C.elegans
XP_002937727.1 pdxdc1 X.tropicalis


Support Center