Display Settings:

Format

Send to:

Choose Destination
HomoloGene:22482. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002415.1          1   --------MFSLKTLPFLLLLHVQISKAFPV---SSKEKNTKTVQDYLEK   39
XP_003313323.1       1   --------MFSLKMLPFLLLLHVQISKAFPV---SSKEKNTKIVQDYLEK   39
XP_001098000.2       1   --------MFSLKMLLFLLLLHVQISKAFPV---SSKEENTKIVQDYLEK   39
XP_546547.3          1   MAAFADKATLDLRKLPLLLLLCVQLSHTFPVRGESPEEKSTRVVQDYLEK   50
XP_002692980.2       1   --------MFSLKMLPLLLLLHVQLSRAFPVSFASLEEKNRNIVQNYLEK   42
NP_032637.3          1   --------MFRLKTLPLLIFLHTQLANAFPV-PEHLEEKNIKTAENYLRK   41
NP_071557.1          1   --------MLHLKTLPFLFFFHTQLATALPVPPEHLEEKNMKTAENYLRK   42
XP_005169256.1       1   -----MKTCFRLCVFVTLLF----SGHSNPIAPLAGGDQDT-LAENYLTR   40


NP_002415.1         40   FYQLPSNQYQSTRKNG----TNVIVEKLKEMQRFFGLNVTGKPNEETLDM   85
XP_003313323.1      40   FYQLPSNQYQSTRKNG----TNVIVEKLKEMQRFFGLNVTGKPNEETLDM   85
XP_001098000.2      40   FYQLPSNQYQSTRKNG----TSMIVEKLKEMQRFFGLNVTGKPNEETLDM   85
XP_546547.3         51   FYQLPRNRFQSERKNS----TSVIMEKLREMQRFFGLNETGKPNQETLEM   96
XP_002692980.2      43   FYQLPRFKYKSERKSK----TNVIVETLKRMQQFFGLNVTGKPNEETLEM   88
NP_032637.3         42   FYNLPSNQFRSSRN------ATMVAEKLKEMQRFFSLAETGKLDAATMGI   85
NP_071557.1         43   FYHLPSNQFRSARN------ATMIAEKLKEMQRFFGLPETGKPDAATIEI   86
XP_005169256.1      41   LYGLPKQPAQSPSSSGGEKRSSDMSLRLKEMQQFFKLKVTGKLDQETLEV   90


NP_002415.1         86   MKKPRCGVPDSGGFMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKD   135
XP_003313323.1      86   MKKPRCGVPDSGGFMLTPGNPKWEHTNLTYRIRNYTPQLSEAEVERAIKD   135
XP_001098000.2      86   MKKPRCGVPDSGDFMLTPGNPKWERTNLTYSILNYTPQLSETDVEGAIKK   135
XP_546547.3         97   MQKPRCGVPDSGDFMLTPGNPKWKQTNLTYRIIKYTPQLSEANVETAIQK   146
XP_002692980.2      89   MRKPRCGVPDSGSFMRTPGNPKWEKTKLTYRIVNYTPNLTEMDVEAIIEE   138
NP_032637.3         86   MEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEK   135
NP_071557.1         87   MEKPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEK   136
XP_005169256.1      91   MKKPRCGVPDIKAYSTFPGDYKWKKHQLTYRIENYTLDMSVAEVDDSISR   140


NP_002415.1        136   AFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQ   185
XP_003313323.1     136   AFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQ   185
XP_001098000.2     136   AFEVWSKASPLTFTRISQGQADINIAFFQRDHGDNSPFDGPNGILAHAFQ   185
XP_546547.3        147   AFQVWSNVSPLTFTKVSQGEVDIRISFVQGDHGDNSPFDGPNGILAHAFQ   196
XP_002692980.2     139   AFKVWSKVSPLTFNRTLDEEADIQISFAQRDHGDNSPFDGPDGILAHAFQ   188
NP_032637.3        136   AFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGILAHAFQ   185
NP_071557.1        137   AFKIWSVPSTLTFTETLEGEADINIAFVSRDHGDNSPFDGPNGILAHAFQ   186
XP_005169256.1     141   ALKVWADVTPLRFTRIYSGTADIMIFFATGDHGDGYPFDGPNGFLAHAYP   190


NP_002415.1        186   PGQGIGGDAHFDAEETWT-NTSANYNLFLVAAHEFGHSLGLAHSSDPGAL   234
XP_003313323.1     186   PGQGIGGDAHFDAEETWT-DTSANYNLFLVAAHEFGHSLGLAHSSDPGAL   234
XP_001098000.2     186   PGQGIGGDAHFDAEETWT-KTSTNYNLFLVAAHEFGHSLGLAHSSDPGAL   234
XP_546547.3        197   PGQGIGGDVHFDAEETWT-ENSSNYNLFLVAAHEVGHSLGLSHSTDPGAL   245
XP_002692980.2     189   PGPGIGGDVHFDAEETWT-KTSENYNLFPVAAHEFGHSLGLAHSSDPGAL   237
NP_032637.3        186   PGQGIGGDAHFDSEETWT-QDSKNYNLFLVAAHEFGHSLGLSHSTDPGAL   234
NP_071557.1        187   PGRGIGGDAHFDSEETWT-QDSKNYNLFLVAAHEFGHSLGLSHSTDPGAL   235
XP_005169256.1     191   PYEGVGGDAHFDDDETFSYRSPQYYTLFSVAAHEFGHSLGLGHSRDPGAL   240


NP_002415.1        235   MYPNYAFRETSNYSLPQDDIDGIQAIYGL----SSNPIQPTGPSTPKPCD   280
XP_003313323.1     235   MYPNYAFRETSNYSLPQDDIDGIQAIYGL----SSNPIQPTGPSTPKPCD   280
XP_001098000.2     235   MYPNYAFRETSNYSLPQDDINGIQAIYGP----SSNPIQPTGPSTPKSCD   280
XP_546547.3        246   MYPNYVFHDPSTYTLPQDDINGIQTIYGP----SSNPVQPTGPSTPTTCD   291
XP_002692980.2     238   MYPNYAFIDPSSYSLHQDDINGIQAIYGP----SSNPVQPTGPTTPTACD   283
NP_032637.3        235   MYPNYAYREPSTYSLPQDDINGIQTIYGP----SDNPIQPTGPSTPKACD   280
NP_071557.1        236   MYPNYAYREPSTYSLPQDDINGIQTIYGP----SDNPVQPTGPSTPTACD   281
XP_005169256.1     241   MYPTYVYRDMDRFILPRDDVNGIQSLYGPNTDVNTDDSKPTPPVTPNTCD   290


NP_002415.1        281   PSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQ   330
XP_003313323.1     281   PSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQ   330
XP_001098000.2     281   PRLTFDAITTLRGEILFFKDRYFWRRHPHLQSVEMNFISLFWPSLPTGIQ   330
XP_546547.3        292   PRLTFDAIATLRGEILFFKDKYFWRRHPQLPRVELNFISLFWPSLPDGIQ   341
XP_002692980.2     284   PRLTFDAVTTLRGEILFFKDKYVWRKHPRLRMAEFNFISLYWPSLPNGIH   333
NP_032637.3        281   PHLRFDATTTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQ   330
NP_071557.1        282   PHLRFDAATTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQ   331
XP_005169256.1     291   PNLVLDAVTMLRGEIMFFKNSFFWRSYPQSPDVELQLIQSFWPEIPDNID   340


NP_002415.1        331   AAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAA   380
XP_003313323.1     331   AAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDIANYGFPSSVQAIDAA   380
XP_001098000.2     331   AAYEDFDRDLIFLFKGNQYWAVSGYDIQQGYPRDISNYGFPSSVQAIDAA   380
XP_546547.3        342   AAYEDVDKDLVFLFKGSQYWALSGYDIKQGYPKDISDYSFPSSVQAIDAA   391
XP_002692980.2     334   AAYEDFDRDLIFIFKGTQYWALSGYDTQQGYPRHISSYGFPSSVQAIDAA   383
NP_032637.3        331   AAYEDFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAA   380
NP_071557.1        332   AAYEDFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAA   381
XP_005169256.1     341   AAFESVIQDKVFLIKGEKVWALYGYDIVQGYPKSLSMFRLRKNVKKIDAV   390


NP_002415.1        381   VFY--RSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVF   428
XP_003313323.1     381   VFY--RSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVF   428
XP_001098000.2     381   VFY--RSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGTFPGIENKVDAVF   428
XP_546547.3        392   VYY--RRKTYFFVNDQVWRYDNQRQSMEPGYPKSIASIFPGIESTVDAVF   439
XP_002692980.2     384   VSY--RRKTYFFVNDQFWSYDDQSQSMEPGYPQSIASFFPGIESRVDAVF   431
NP_032637.3        381   VSY--NGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGVNCRVDAVF   428
NP_071557.1        382   VSY--NGKTYFFVNNQCWRYDNQRRSMDPGYPTSIASVFPGINCRIDAVF   429
XP_005169256.1     391   LYKEDSNTILFFANNQVYSYNERMKKMDKGFPKPVQKVFPGMTGKVTAAF   440


NP_002415.1        429   QQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG   467
XP_003313323.1     429   QQEHFFLFFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG   467
XP_001098000.2     429   QQEHFFLFFSGPRYYAFDLIAERVTRVARANKWLNCRYS   467
XP_546547.3        440   QQNHVFLFFSGPRYYAFDLGAHEVIRVGRSNRWLNCR--   476
XP_002692980.2     432   QENSLFLFFSGPRYYAFDFHARRVTRVDRSNTWLNCWYS   470
NP_032637.3        429   LQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS--   465
NP_071557.1        430   QQDSFFLFFSGPQYFAFNLVSRRVTRVARSNLWLNCP--   466
XP_005169256.1     441   QYRGFNYLFSGSKMLEFG-SNNKLLRVLNNNYFLPCK--   476


Protein Acc. Gene Organism
NP_002415.1 MMP8 H.sapiens
XP_003313323.1 MMP8 P.troglodytes
XP_001098000.2 MMP8 M.mulatta
XP_546547.3 MMP8 C.lupus
XP_002692980.2 MMP8 B.taurus
NP_032637.3 Mmp8 M.musculus
NP_071557.1 Mmp8 R.norvegicus
XP_005169256.1 mmp13a D.rerio


Support Center