Display Settings:

Format

Send to:

Choose Destination
HomoloGene:2137. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002845.1          1   -----------------------------------MSMTDLLNAEDI---   12
XP_525585.2          1   -----------------------------------MSMTDLLNAEDI---   12
XP_001085875.2       1   -------------MKKTYGDKEEGHLGSQEFTHELDPTIDSLSALEILFR   37
XP_003431553.1       1   -----------------------------------MSMTDLLNAEDI---   12
NP_001069582.1       1   -----------------------------------MSMTDLLHAEDI---   12
NP_038673.2          1   -----------------------------------MSMTDVLSAEDI---   12
NP_071944.1          1   -----------------------------------MSMTDLLSAEDI---   12
NP_001152787.1       1   -----------------------------------MAMTDVLSAEDI---   12
NP_991136.1          1   -----------------------------------MAMSSILNHDDI---   12
XP_004913949.1       1   MQAAAVKSTAPRSDESSRTYSATQSVSFFCRSRAAMSMTDVLAAADI---   47


NP_002845.1              --------------------------------------------------
XP_525585.2              --------------------------------------------------
XP_001085875.2      38   LGMRRGTFYGAQDMEEGNIAAIYSSHRRLYGGEVAPFPLCPGRSPWDPAD   87
XP_003431553.1           --------------------------------------------------
NP_001069582.1           --------------------------------------------------
NP_038673.2              --------------------------------------------------
NP_071944.1              --------------------------------------------------
NP_001152787.1           --------------------------------------------------
NP_991136.1              --------------------------------------------------
XP_004913949.1           --------------------------------------------------


NP_002845.1         13   ------------------------------------------------KK   14
XP_525585.2         13   ------------------------------------------------KK   14
XP_001085875.2      88   PRPGGAGADFSRQAVAIVGPLTALVPLLRFSSGPAGEVTFWIRRTALPKP   137
XP_003431553.1      13   ------------------------------------------------KK   14
NP_001069582.1      13   ------------------------------------------------KK   14
NP_038673.2         13   ------------------------------------------------KK   14
NP_071944.1         13   ------------------------------------------------KK   14
NP_001152787.1      13   ------------------------------------------------KK   14
NP_991136.1         13   ------------------------------------------------KK   14
XP_004913949.1      48   ------------------------------------------------KN   49


NP_002845.1         15   AVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDEL   64
XP_525585.2         15   AVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDEL   64
XP_001085875.2     138   ARGTFT-IDSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDEL   186
XP_003431553.1      15   AVGAFTAVDSFDHKKFFQMVGLKKKSPDDVKKVFHILDKDKSGFIEEDEL   64
NP_001069582.1      15   AVGAFTAVDSFDHKKFFQMVGLKKKSPEDVKKVFHILDKDKSGFIEEEEL   64
NP_038673.2         15   AIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDEL   64
NP_071944.1         15   AIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDEL   64
NP_001152787.1      15   AVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIEEEEL   64
NP_991136.1         15   ALDACKAPDSFNHKSFFEMVGLKAKASDDVKKAFHLLDADNSGFIEEEEL   64
XP_004913949.1      50   ALGAFGAPDSFNHKKFFELCGLKKKSPDDVKKVFHILDKDRSGFIEEDEL   99


NP_002845.1         65   GFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES   110
XP_525585.2         65   G---------------------------------------------   65
XP_001085875.2     187   GFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES   232
XP_003431553.1      65   GFILKGFSPDARDLSVKETKTLMAAGDKDGDGKIGVDEFSSLVAES   110
NP_001069582.1      65   GFILKGFSPDARDLSVKETKTLLAAGDKDGDGKIGADEFSTLVAES   110
NP_038673.2         65   GSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES   110
NP_071944.1         65   GSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES   110
NP_001152787.1      65   KFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMVAES   110
NP_991136.1         65   KFVLKAFATDGRDLTDKETKAFLQAADKDGDGKIGAEEFAALVRE-   109
XP_004913949.1     100   KLLLQGFATDGRALSDKETKALLAAGDKDGDGKIGVDEFTALVAES   145


Protein Acc. Gene Organism
NP_002845.1 PVALB H.sapiens
XP_525585.2 PVALB P.troglodytes
XP_001085875.2 LOC697272 M.mulatta
XP_003431553.1 PVALB C.lupus
NP_001069582.1 PVALB B.taurus
NP_038673.2 Pvalb M.musculus
NP_071944.1 Pvalb R.norvegicus
NP_001152787.1 PVALB G.gallus
NP_991136.1 pvalb6 D.rerio
XP_004913949.1 LOC100486372 X.tropicalis


Support Center