Display Settings:

Format

Send to:

Choose Destination
HomoloGene:21324. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_006642.1          1   MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKA   50
XP_001094482.1       1   MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKA   50
XP_005618765.1       1   MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQEEEERKA   50
NP_001071571.1       1   MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQEEEERKA   50
NP_031782.3          1   MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKA   50
NP_074055.1          1   MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKA   50
XP_424869.1          1   MDFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQEEEERKA   50
XP_005173398.1       1   MNFVMKQALGGATKDMGKMLGGEEEKDPDAERKEEERQEALRQQEEERKA   50
NP_001096263.1       1   MDFVMKQALGGATKDMGKMLGGDEEKDPDAQKKMEEAQEALRQQEDERKA   50


NP_006642.1         51   KYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA   100
XP_001094482.1      51   KYAKMEAEREAMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA   100
XP_005618765.1      51   KYAKMEAEREAMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA   100
NP_001071571.1      51   KYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAALEANSEGSLTRPKKA   100
NP_031782.3         51   KYAKMEAEREVMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA   100
NP_074055.1         51   KYAKMEAEREVMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA   100
XP_424869.1         51   KYAKMEAEREVMRQGIRDKYGIKKKEEKEAEAQAALEANAEGSLTRPKKA   100
XP_005173398.1      51   KYAKMEAERESVRQGIRDKYGIKKKEEKEAEAAAALEQAAEGSLTRPKKA   100
NP_001096263.1      51   KYAKMEAEREIMRQGIRDKYGIKKKEEKEAEAQAAMEATSEGSLTRPKKA   100


NP_006642.1        101   IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK-   134
XP_001094482.1     101   IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK-   134
XP_005618765.1     101   IPPGCGDEPEEEDESILDTVIKYLPGPLQDMFKK-   134
NP_001071571.1     101   IPPGCGDAAEEEDESILDTVIKYLPGPLQDIFKK-   134
NP_031782.3        101   IPPGCGDEPEEEDESILDTVIKYLPGPLQDMFKK-   134
NP_074055.1        101   IPPGCGDEPEEEDESILDTVIKYLPGPLQDMFKK-   134
XP_424869.1        101   IPPGCGEEEEEEEESILDTVIKYLPGPLQDMFKK-   134
XP_005173398.1     101   IPAGCGDD-EEEEESIVDTVMKFLPGPLQDMFNKK   134
NP_001096263.1     101   IPAGCGDE-EEEEESILDTVIKYLPGPLQDMFKK-   133


Protein Acc. Gene Organism
NP_006642.1 CPLX1 H.sapiens
XP_001094482.1 CPLX1 M.mulatta
XP_005618765.1 CPLX1 C.lupus
NP_001071571.1 CPLX1 B.taurus
NP_031782.3 Cplx1 M.musculus
NP_074055.1 Cplx1 R.norvegicus
XP_424869.1 CPLX2 G.gallus
XP_005173398.1 LOC563082 D.rerio
NP_001096263.1 cplx1 X.tropicalis


Support Center