Display Settings:

Format

Send to:

Choose Destination
HomoloGene:21237. Gene conserved in Tetrapoda Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_006135.1          1   ----------MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSR   40
XP_001148261.1       1   ----------MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSR   40
XP_001097639.1       1   ----------MRNSYRFLASSLSVVVFLVLIPEDVCEEIIGGNEVTPHSR   40
XP_544335.3          1   MPIDVGTAATMRNSCTFPASSFSIAIFLLLVPGDFCVEIIGGNQVSPHSR   50
NP_001092565.1       1   ----------MRNSSTFLAATLSIVVFL-LIPEDLCEKIIGGNQVTPHSR   39
NP_034500.1          1   ----------MRNASGPRGPSLATLLFLLLIPEGGCERIIGGDTVVPHSR   40
NP_703198.1          1   ----------MRNPCAPWVSSLTTVIFLLLIPEGGCERIIGGDTVVPHSR   40
NP_989788.1          1   -------------MGVFFTLSTSAAIVLLILPGDLCVDIIGGHEVAPHSR   37
XP_002941159.1       1   -------MAGLKTSTVFL---FTAAAFFLVIWQCECTEIIGGREAVPHSR   40


NP_006135.1         41   PYMVLLSLDR---KTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITR   87
XP_001148261.1      41   PYMVLLSLDR---KNICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITR   87
XP_001097639.1      41   PYMVLLSLDG---KTICAGALIAKDWVLTAAHCNLDKRFQVILGAHSITR   87
XP_544335.3         51   PYMVLL--KG---KKICAGALIAEDWVLTAAHCVLDKNSQVILGAHSITK   95
NP_001092565.1      40   PYMVLL--DG---GNICAGALIAKDWVLTAAHCSLNQKSQIILGAHSRNK   84
NP_034500.1         41   PYMALLKLSS---NTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSI-N   86
NP_703198.1         41   PYMVLLKLKP---DSICAGALIAKNWVLTAAHCIPGKKSEVILGAHSI-K   86
NP_989788.1         38   PFMAML--KG---KEFCGGALIKPSWVLTAAHCNL-KGGRVILGAHSRTK   81
XP_002941159.1      41   PYMVALYLREKKFKTICGGVLIKPSWVLTAAHCNITEKTKIIIGAHSLTA   90


NP_006135.1         88   EEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPK   137
XP_001148261.1      88   EEPTKQIMLVKKEFPYPCYDPDTREGDLKLLQLTEKAKINKYVTILHLPK   137
XP_001097639.1      88   KEREKQIMRVKKEFPYPCYDPATHEGDLKLLQLTEKAKINKYVTILHLPK   137
XP_544335.3         96   KESEKQIMFVKKEFPYPCFDPDTHEGDLKLLQLKKKAKVNKKVSILRLPK   145
NP_001092565.1      85   EEPEKQIMFVKKEFPYPCYDPDTHEGDLKLLKLNKKATLNKNVAILQLPK   134
NP_034500.1         87   KEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPK   136
NP_703198.1         87   KEPEQQILSVKKAYPYPCFDKHTHEGDLQLLRLKKKATLNKNVAILHLPK   136
NP_989788.1         82   REEEEQVIEIAEEIRYPDYCPERKEHDIMLLKLKKRAKINSAVKVIPLPT   131
XP_002941159.1      91   KESQKQIIPIIKKFQHEDFRIETFDYDVQLLQLSKAAVLGSDVSVLPLSV   140


NP_006135.1        138   KGDDVKPGTMCQVAGWGRTHNSASW-SDTLREVNITIIDRKVCNDRNHYN   186
XP_001148261.1     138   KGDDVKPGTMCQVAGWGRTHNSASR-SDTLREVNITIIDRKVCNDQNHYN   186
XP_001097639.1     138   KGDDVKPGTMCQVAGWGKIHNSASQ-SDTLREVNITIIDRKICNDPNHYN   186
XP_544335.3        146   RGDDVKPGTMCRVAGWGRIHNNSPQ-SDTLREVNITVINRRICNDEKHYN   194
NP_001092565.1     135   EGKDVEPGTACRVAGWGQFYNNSPV-SKILREVNVTIIDRKICNDQSHYN   183
NP_034500.1        137   KGDDVKPGTRCRVAGWGRFGNKSAP-SETLREVNITVIDRKICNDEKHYN   185
NP_703198.1        137   KGDDVKPGTRCHVAGWGRFHNKSPP-SDTLREVNITVIDRKICNDEKHYN   185
NP_989788.1        132   SGDDLKQGTICSVAGWGQISKRGNKMSDTLREVNVTVISRRICNDKKHYR   181
XP_002941159.1     141   KRKKLQPGTVCETAGWGTTTNHRNIISDKLMEVNVTIVDTKTCAK----R   186


NP_006135.1        187   FNPVIGM--NMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKC   234
XP_001148261.1     187   FNPVIGM--NMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKC   234
XP_001097639.1     187   FNPVIGM--NMVCAGSLRGGKDSCNGDSGSPLLCNGVFRGVTSFGRKNKC   234
XP_544335.3        195   YNPVIGL--NMICAGSLNGGKDSCNGDSGSPLICEGIFRGVTAFGLPGKC   242
NP_001092565.1     184   YNPVIGL--NMICAGSLQGGKDSCHGDSGSPLICKDTFRGITAFGIPGRC   231
NP_034500.1        186   FHPVIGL--NMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGE-KC   232
NP_703198.1        186   FNPVIGL--NMICAGNLRGGKDSCYGDSGGPLLCEGIFRGITAFGLEGRC   233
NP_989788.1        182   KEPRITD--NMICAGSKRGDKDSCRGDSGGPLICNNVMKGITSFG-KSPC   228
XP_002941159.1     187   WKPLINITRNMICTSENVEVKGTCGGDSGGPLICNGSLRGLTSFGMP-EC   235


NP_006135.1        235   GDPRGPGVYILLSKKHLNWIIMTIKGAV----   262
XP_001148261.1     235   GDPRGPGVYTLLSKKHLNWIIMTIKGAV----   262
XP_001097639.1     235   GDPGGPGVYILLSKKHLSWIIMTIKGAV----   262
XP_544335.3        243   GDPRGPGIYTFLSQKYLSWINKTMKGVV----   270
NP_001092565.1     232   GDPRGPGVYTLLSKKHLNWIVKTMKQAV----   259
NP_034500.1        233   GDRRWPGVYTFLSDKHLNWIKKIMKGSV----   260
NP_703198.1        234   GDPKGPGIYTLLSDKHLDWIRKTAKGAV----   261
NP_989788.1        229   GDPGGPGVYTRITDKYLKWIRKTIGGDLLTGF   260
XP_002941159.1     236   ALPGDASVYAKLNRNIIRWINKIISGVH-KIF   266


Protein Acc. Gene Organism
NP_006135.1 GZMA H.sapiens
XP_001148261.1 GZMA P.troglodytes
XP_001097639.1 GZMA M.mulatta
XP_544335.3 GZMA C.lupus
NP_001092565.1 GZMA B.taurus
NP_034500.1 Gzma M.musculus
NP_703198.1 Gzma R.norvegicus
NP_989788.1 GZMA G.gallus
XP_002941159.1 LOC100497188 X.tropicalis


Support Center