Display Settings:

Format

Send to:

Choose Destination
HomoloGene:20874. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001185593.1           --------------------------------------------------
XP_003312268.2       1   MTTQERKKNFQRGACLLPPTPSSRPTPSRFLLILGAPASLEDPPLCGSPP   50
XP_001105626.1           --------------------------------------------------
NP_001191931.1           --------------------------------------------------
NP_001107984.1           --------------------------------------------------
NP_079553.1              --------------------------------------------------
NP_446112.1              --------------------------------------------------
NP_001191934.1           --------------------------------------------------
NP_001191955.1           --------------------------------------------------
NP_001191941.1           --------------------------------------------------


NP_001185593.1       1   -------------------MSSGASASALQRLVEQLKLEAGVERIKVSQA   31
XP_003312268.2      51   RFQAQLQPGPAALGAQRRRHVSGASASALQRLVEQLKLEAGVERIKVSQA   100
XP_001105626.1       1   -------------------MSSGASASALQRLVEQLKLEAGVERIKVSQA   31
NP_001191931.1       1   -------------------MSSGASVNALQRLVEQLKLEAGVERIKVSQA   31
NP_001107984.1       1   -------------------MSSGASVSALQRLVEQLKLEAGVERIKVSQA   31
NP_079553.1          1   -------------------MSSGASVSALQRLVEQLKLEAGVERIKVSQA   31
NP_446112.1          1   -------------------MSSGASVSALQRLVEQLKLEAGVERIKVSQA   31
NP_001191934.1       1   -------------------MSSAGSLSTMQRLVEQLKLEAAVERIKVSQA   31
NP_001191955.1       1   -------------------MSSNSNLTTLRRSVEQLKLEASVERIKVSQA   31
NP_001191941.1       1   -------------------MSSNSNFSTMQRVVEQLRLEASVERIKVSQA   31


NP_001185593.1      32   AAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL   68
XP_003312268.2     101   AAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL   137
XP_001105626.1      32   AAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL   68
NP_001191931.1      32   AAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALF   68
NP_001107984.1      32   AAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL   68
NP_079553.1         32   AAELQQYCIQNACKDALLLGVPAGSNPFREPRSCALL   68
NP_446112.1         32   AAELQQYCIQNACKDALLLGVPAGSNPFREPRSCALL   68
NP_001191934.1      32   AAELQQYCMQNACKDALLVGVPAGSNPFREPRSCTLL   68
NP_001191955.1      32   AADLQEYCLQNASKDALLVGLPAASNPFREPRSCTLL   68
NP_001191941.1      32   AAELQQYCMQNACKDALLVGMPAGSNPFREPRSCALL   68


Protein Acc. Gene Organism
NP_001185593.1 GNG10 H.sapiens
XP_003312268.2 LOC100611518 P.troglodytes
XP_001105626.1 GNG10 M.mulatta
NP_001191931.1 GNG10 C.lupus
NP_001107984.1 GNG10 B.taurus
NP_079553.1 Gng10 M.musculus
NP_446112.1 Gng10 R.norvegicus
NP_001191934.1 GNG10 G.gallus
NP_001191955.1 gng10 D.rerio
NP_001191941.1 gng10 X.tropicalis


Support Center