Display Settings:

Format

Send to:

Choose Destination
HomoloGene:20663. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_003043.3          1   MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQ--------------   36
XP_001142298.2       1   MLSYGERLGSPAVSPLPVHGGHVMRGTAFAYVPSPQ--------------   36
XP_001089538.1       1   MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQ--------------   36
XP_852242.1          1   MMSYGERLGAPAVSPHPVRGGHVIRGTAFAYVPSPQ--------------   36
NP_001096693.1       1   MMSYGEKVGGRAVSPLPVRGGHMMHGAAFAYVPSPQ--------------   36
NP_035522.2          1   MMSYSERLGGPAVSPLPVRGRHMVHGATFAYVPSPQ--------------   36
NP_037162.1          1   MMSYSERLGGPAVSPLPVRGRHMVHGAAFAYVPSPQ--------------   36
XP_425204.4          1   MLSY--RRESPAMPRCPVRGGRVVHGTPFAYCPSPQGRSPSPPPHHPPLH   48
XP_002664304.2       1   ------------MCSRPIRITTAEQTISIA--------------------   18
NP_508581.2          1   MYQHQIIPDYYYRSYTPYRGHHFMPGARV---------------------   29


NP_003043.3         37   --------------------------------VLHRIPGTSAYAFPSLGP   54
XP_001142298.2      37   --------------------------------VLHRIPGTSAYAFPSLGP   54
XP_001089538.1      37   --------------------------------VLHRIPGTSAYAFPSLGP   54
XP_852242.1         37   --------------------------------VLHRIPGTSAYAFPSLGP   54
NP_001096693.1      37   --------------------------------VLHRIPGTSAYGFPSVGP   54
NP_035522.2         37   --------------------------------VLHRIPGTSTYAISSLSP   54
NP_037162.1         37   --------------------------------VLHRIPGTTTYAISSLSP   54
XP_425204.4         49   AELSSASPHQEGSMPSTSRNQGHNARWVRLYPALHRLPGAHACPF-AVGA   97
XP_002664304.2      19   --------------------------------VGCHDAGKCSSSLDLVSN   36
NP_508581.2              --------------------------------------------------


NP_003043.3         55   VALAEHT--CPC--GEVLERH-----EPLP---AKLALEEEQKPESRLVP   92
XP_001142298.2      55   VALAEHT--CPC--GEVLERH-----EPLP---AKLALEEEQKSESRLVP   92
XP_001089538.1      55   VALAEHT--CPC--GEILERH-----EPLP---AKLALEEEQKPEPRLVS   92
XP_852242.1         55   VALPEHG--CPY--GEVLECH-----DPLP---AKLALEEDQKPELGLAQ   92
NP_001096693.1      55   VALPEHG--CPY--GEVVEHH-----DPLP---AKLALEDERKPEPGLVQ   92
NP_035522.2         55   VTLTEHS--CPC--GEVLECH-----DPLP---TKLAQEEEQKPEPRLSQ   92
NP_037162.1         55   VALTEHS--CPY--GEVLECH-----DPLP---AKLAQEEEQKPEPRLSQ   92
XP_425204.4         98   VSCPDHGFLCPGSPGRLVESRERYELDALPWQGPRLGLEELQKPELGCWV   147
XP_002664304.2      37   ---------CGDADADASSIHWETGKHPCT---TTMSSDSSESRSAGMFS   74
NP_508581.2         30   --------------GDETE-------PPAH---KKSIISWTSTPTKHKVK   55


NP_003043.3         93   KLRQAGAMLLKVPLMLTFLYLFVCSLDMLSSAFQLAGGKVAGDIFKDNAI   142
XP_001142298.2      93   KLCQAGAMLLKVPLMLTFLYLFVCSLDMLSSAFQLAGGKVAGDIFKDNAI   142
XP_001089538.1      93   KLRQAGAMLLKVPLMLSFLYLFICSLDVLSSAFQLAGGKVAGDIFKDNAI   142
XP_852242.1         93   KLCQVGMTFLKVPLMLAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAI   142
NP_001096693.1      93   KLHRAGVTLLKVPLMLSFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAI   142
NP_035522.2         93   KLAQVGTKLLKVPLMLAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAI   142
NP_037162.1         93   KLAQVGTKLLKVPLMLGFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAI   142
XP_425204.4        148   RVQSICVSLLKVPLMFGFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAI   197
XP_002664304.2      75   -------SVLRIPLLLLLLYGFVCSLDVLSSAFQLAGGKVAGDIFQDSVI   117
NP_508581.2         56   YYITCSFLIF---LILLVLFIYVCSLANMSTAFGLLGSRGLGKAIQESPL   102


NP_003043.3        143   LSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSN   192
XP_001142298.2     143   LSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSN   192
XP_001089538.1     143   LSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSN   192
XP_852242.1        143   LSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSN   192
NP_001096693.1     143   LSNPVAGLVVGILVTVLVQSSSTSTSIVVSMVSSGLLEVSSAIPIIMGSN   192
NP_035522.2        143   LSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSN   192
NP_037162.1        143   LSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSN   192
XP_425204.4        198   LSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVRSAIPIIMGSN   247
XP_002664304.2     118   LSNPVAGLMVGILVTVLVQSSSTSTSIIVSLVSSGLLEVKSAVPIIMGSN   167
NP_508581.2        103   INDPISAVVVGMLATVVLQSATTTTNILVTMVAANMITVHDAIPVMIGSE   152


NP_003043.3        193   IGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATG   242
XP_001142298.2     193   IGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATG   242
XP_001089538.1     193   IGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATG   242
XP_852242.1        193   IGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATG   242
NP_001096693.1     193   IGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATG   242
NP_035522.2        193   IGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATG   242
NP_037162.1        193   IGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATG   242
XP_425204.4        248   IGTSVTNTIVALMQAGDRSEFKRAFAGATVHDCFNWLSVLVLLPLEVVSG   297
XP_002664304.2     168   IGTSVTNTIVALMQAGERNEFKRAFAGATIHDCFNWLSVLVLLPLEVFSG   217
NP_508581.2        153   LGSSLVNAMVSLAYSGKPEQFRRAFSAAILGDVFNVCGLFVIFPMEMFTG   202


NP_003043.3        243   YLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATG   292
XP_001142298.2     243   YLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATG   292
XP_001089538.1     243   YLHHITQLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDKSVITSIATG   292
XP_852242.1        243   YLHHVTGLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDKSVITSIATG   292
NP_001096693.1     243   YLHCITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDKSVITSLASG   292
NP_035522.2        243   YLHHVTGLVVASFNIRGGRDAPDLLKVITEPFTRLIIQLDKSVITSIAVG   292
NP_037162.1        243   YLHHVTGLVVASFNIRGGRDAPDLLKVITEPFTKLIIQLDKSVITSIAVG   292
XP_425204.4        298   YLHHVTRLVVATFNIRSGKDAPDLLKIITEPFTKLIIQLDKSVITGIATG   347
XP_002664304.2     218   LLSFLARVTVSSFQMHSGEEAPELLKTLTEPFTTLIIQLDKSVITGIALG   267
NP_508581.2        203   LIEKVSWWIVDPLISEQGLSF-KTLELLTDPINQVILQVNEVELLNATIR   251


NP_003043.3        293   DESLR-NHSLIQIWCHPDSLQAPTSMSRAEA----------------NSS   325
XP_001142298.2     293   DESLR-NHSLIRIWCHPDSLQAPTSMSRAEA----------------NSS   325
XP_001089538.1     293   DESLR-NHSLIRIWCHPDSLEAPTSMSRAEA----------------NSS   325
XP_852242.1        293   DESLR-NHSLIRIWCHPDPMGVPTLMPRAEA----------------NTS   325
NP_001096693.1     293   DESLR-NHSLIRVWCYPDPTEVPTPMPRAEA----------------NTS   325
NP_035522.2        293   DESLR-NHSLIRIWCHPDTTEASTSMSRVEA----------------IGS   325
NP_037162.1        293   DESLR-NHSLIRIWCQPETKEASTSMSRVEA----------------IGS   325
XP_425204.4        348   DESLR-NRSLIRMWCGPAP-------PQTAA----------------GGV   373
XP_002664304.2     268   DESMR-NHSLIKVWCKSSVLVSSVNVTHAAVRNCTGLHCGRDGDLTWITQ   316
NP_508581.2        252   PEMFEANHSFV------------------------------------QRC   265


NP_003043.3        326   QTLGNATMEKC--NHIFVDTGLPDLAVGLILLAGSLVLLCTCLILLVKML   373
XP_001142298.2     326   QTLGNATMEKC--NHIFVDTGLPDLAVGLILLAGSLVLLCTCLILLVKML   373
XP_001089538.1     326   QTLGNATMEKC--NHIFVDTSLPDLAVGLILLAGSLVLLCTCLILLVKML   373
XP_852242.1        326   RMPGNASMEKC--NHIFVDTGLPDLAVGLILLASSLMVLCTCLILLVKML   373
NP_001096693.1     326   RMLRNATLEKC--NHIFVDTGLPDLAVGLILLAGSLALLCTCLILLVKML   373
NP_035522.2        326   --LANTTMEKC--NHIFVDTGLPDLAVGLILLAGSLVVLCTCLILLVKML   371
NP_037162.1        326   --LANTTMEKC--NHIFVDTGLPDLAVGLILLAGSLVVLCTCLILLVKML   371
XP_425204.4        374   GVPPNCTASGH--CXAVMALGSSTTSPG----------------------   399
XP_002664304.2     317   NITTHINTEKC--RHVFVDTGLSDLAVGLILLAGSLMLLCSCLLFIVKVL   364
NP_508581.2        266   SFTNGTRIYNCPYNHLFSHTSLSDKNIGWIVLFVSIFCLVMCL-------   308


NP_003043.3        374   NSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFT   423
XP_001142298.2     374   NSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFT   423
XP_001089538.1     374   NSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGAGMTFVVQSSSVFT   423
XP_852242.1        374   NSLLKGQVAKVIQKVINTDFPAPFTWATGYFAMVVGAGMTFIVQSSSVFT   423
NP_001096693.1     374   NSLLKGQVAKVIQKVINTDFPTPFTWATGYFAMVVGASMTFVVQSSSVFT   423
NP_035522.2        372   NSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFT   421
NP_037162.1        372   NSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFT   421
XP_425204.4        400   ---RNGQVAKAIQKVINTDLPHPFSWLTGYFAMVVGAGMTFVVQSSSVFT   446
XP_002664304.2     365   NSLLKGQVAKVIEGVINTDFPYPLGWLSGYLAMLMGAGMTFIIQSSSVFT   414
NP_508581.2        309   -KLLDGHAANYVRNLLSKQCPGMWKPCTGYLVMLVG-----LIQSNSIFS   352


NP_003043.3        424   SAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQI   473
XP_001142298.2     424   SAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQI   473
XP_001089538.1     424   SAITPLVGLDVISIERAYPLTLGSNIGTTTTAILAALASPKEKLFSAFQI   473
XP_852242.1        424   SAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAVQI   473
NP_001096693.1     424   SAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQI   473
NP_035522.2        422   SAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQI   471
NP_037162.1        422   SAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQI   471
XP_425204.4        447   SAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPGDKLASSFQI   496
XP_002664304.2     415   SALTPLIGIGVISLNRAYPLTLGSNIGTTTTAILAALASPKEKLPAACQI   464
NP_508581.2        353   SSLTPLVGSGVVTLEQMYPLVLGSNIGTTFSGVLAAFSTDPSRFEKALHM   402


NP_003043.3        474   ALCHFFFNISGILLWYPVPCTR-LPIRMAKALGKRTAKYRWFAVLYLLVC   522
XP_001142298.2     474   ALCHFFFNISGILLWYPVPCTR-LPIHMAKALGKRTAKYRWFAVLYLLVC   522
XP_001089538.1     474   ALCHFFFNISGILLWYPVPCTR-LPIRMAKALGERTAKYRWFAVLYLLVC   522
XP_852242.1        474   ALCHFFFNISGILLWYPVPCTR-LPIRMAKALGKRTAKYRWFAVLYLLLC   522
NP_001096693.1     474   ALCHFFFNISGILLWYPMPCTR-LPIRMAKALGKRTAKYRWFAVLYLLLC   522
NP_035522.2        472   ALCHFFFNISGILLWYPLPCTR-LPIRMAKALGKRTAKYRWFAVLYLLVC   520
NP_037162.1        472   ALCHFFFNISGILLWYPLPCTR-LPIRMAKALGKRTAKYRWFAVLYLLVC   520
XP_425204.4        497   ALCHFFFNISGILLWYPLPFTR-LPIRMAKALGERTAKYRWFAVLYLIIC   545
XP_002664304.2     465   ALCHFYFNIFGILLWYPFPLTR-LPIRMASALGERTAKYRWFAVLYLLLC   513
NP_508581.2        403   AMCQVIYNIIGTCLFYIVPCTRKFPVYLSVKLGVITDHYRWFIVVFISTV   452


NP_003043.3        523   FLLLPSLVFGISMAGWQVMVGVGTPFGALLAFVVLINVLQSRSPGHLPKW   572
XP_001142298.2     523   FLLLPSLVFGISMAGWQVMVGVGTPFGALLAFVVLINVLQSRSPGHLPKW   572
XP_001089538.1     523   FLLLPSLVFGISMAGWQVMVGVGTPFGALLAFVVLINVLQSRSPGHLPKW   572
XP_852242.1        523   FLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVFISVLQNRSPRHLPKW   572
NP_001096693.1     523   FLLLPSMVFGLSMAGWRAMVGVGAPFGALLAFVVLVSVLQSRSPGCLPKW   572
NP_035522.2        521   FLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVLVNVLQSRSPGHLPKW   570
NP_037162.1        521   FLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVLVNVLQSRSPGHLPKW   570
XP_425204.4        546   FLLLPSLIFGISMAGWRVLVGVGAPFLGLLFFVGLVNVLQARSPGRLPKW   595
XP_002664304.2     514   FLLLPCLVFGLSLAGWQAMVGVGAPFVALTLFVLLVNLMQARSPAHLPKT   563
NP_508581.2        453   FLIIPFTIIGLTLLPDNVIVIVFIIILIIAITCCFICVLQNSCKEFLPKI   502


NP_003043.3        573   LQTWDFLPRWMHSLKPLDHLITRAT-LCC-----------------ARPE   604
XP_001142298.2     573   LQTWDFLPRWMHSLKPLDHLITRAT-LCC-----------------ARPE   604
XP_001089538.1     573   LQTWDFLPRWMHSLKPLDHLITRAT-LCC-----------------ARPE   604
XP_852242.1        573   LQTWDFLPRWMHSLQPLDRLITRAT-LCC-----------------ARPE   604
NP_001096693.1     573   LQTWDFLPLWMHSLKPLDRLITRAT-LCC-----------------ARAE   604
NP_035522.2        571   LQTWDFLPRWMHSLQPLDGLITRAT-LCY-----------------ARPE   602
NP_037162.1        571   LQTWDFLPRWMHSLQPLDGLITRAT-LCY-----------------ARPE   602
XP_425204.4        596   LQSWDFLPAWMHSLQPLDSLITRAT-LCCTD-RCRSPEGWDEREAAARDK   643
XP_002664304.2     564   LRSWDFLPQWMHSLKPLDKLISRSTALCCSPLRIKDPEPLVEPSDLQKPA   613
NP_508581.2        503   LHNWSFLPIWMRSLQYYDPF------MCKVFTNIPYIGGFFRKGGAHRER   546


NP_003043.3        605   PR-SPPLPPRVFLEELPPATPSPRLALPA--HHNATRL   639
XP_001142298.2     605   PR-SPPLPPRVFLEELPPATPSPRLALPA--HHNATRL   639
XP_001089538.1     605   PR-SPPLPPRVFLEELPPSTPSPRLALPA--HHNATRL   639
XP_852242.1        605   PR-SPPLPARVFLEEMPPATPSPHLALPA--RHNATRL   639
NP_001096693.1     605   PR-SPPLPARVFLEELPPATPSPHLAMTH--HHNATRL   639
NP_035522.2        603   PR-SPQLPPRVFLEELPPATPSPRLALPA--HHNATRL   637
NP_037162.1        603   PR-SPQLPPRVFLEELPPATPSPRLALPA--HHNATRL   637
XP_425204.4        644   ARLGLDNPVLSYPEEMP--SPALRVGSPHLTPHSATRL   679
XP_002664304.2     614   DQ-CFDNPA---LEEIPAEPRVFRLRGLE--RCNSTPL   645
NP_508581.2        547   TENGK-------YGEDDIEKKVQKLVQLS----GQTQV   573


Protein Acc. Gene Organism
NP_003043.3 SLC34A1 H.sapiens
XP_001142298.2 SLC34A1 P.troglodytes
XP_001089538.1 SLC34A1 M.mulatta
XP_852242.1 SLC34A1 C.lupus
NP_001096693.1 SLC34A1 B.taurus
NP_035522.2 Slc34a1 M.musculus
NP_037162.1 Slc34a1 R.norvegicus
XP_425204.4 SLC34A1 G.gallus
XP_002664304.2 slc34a1a D.rerio
NP_508581.2 ZK563.2 C.elegans


Support Center