Display Settings:

Format

Send to:

Choose Destination
HomoloGene:20523. Gene conserved in Tetrapoda Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002263.3              --------------------------------------------------
XP_003313727.2           --------------------------------------------------
XP_002798645.1           --------------------------------------------------
XP_003433546.1       1   MTSEGVFSDILSRYEKDGPVPKAKPRDVSDFSLYAPATKPCCSSAYKRPG   50
NP_001091855.1           --------------------------------------------------
NP_032501.2              --------------------------------------------------
NP_001008806.1           --------------------------------------------------
XP_001231586.2           --------------------------------------------------
XP_002935776.1           --------------------------------------------------


NP_002263.3          1   -----------------------MIARQQCVRGGPRGFSCGSAIVGGGKR   27
XP_003313727.2       1   -----------------------MIARQQCVRGGPRGFSCGSAIVGGGKR   27
XP_002798645.1       1   -----------------------MIARQQCVRGGPRGFSCGSAIVGSGKR   27
XP_003433546.1      51   LXAAALTSWPPALLEAPARSPAPMIARQQGAR-GSRAFSCGSAVVGGGRR   99
NP_001091855.1       1   -----------------------MIARQQYVRGGPRGFSCGSAIVGGVKK   27
NP_032501.2          1   -----------------------MIARQSSVRGASRGFSSGSAIAGGVKR   27
NP_001008806.1       1   -----------------------MISRQSSVRGVSRGFSSGSAVAGGVKR   27
XP_001231586.2       1   ------------------------MSRQSSA--FKKGFSSSSACLGGKNK   24
XP_002935776.1       1   -------------------------------MSHYKQFSVRSVATSGKPG   19


NP_002263.3         28   GAFSSVSMSGGAGRCSSGG--FGSRSLYNLRGNKSISM---SVAGSRQGA   72
XP_003313727.2      28   GAFSSVSMSGGAGRCSPGG--FGSRSLYNLRGNKSISM---SVAGSRQGA   72
XP_002798645.1      28   GAFSSVSVSGGAGRCSSGG--FGSRSLYNLGGNKSISM---SVAGSRQGA   72
XP_003433546.1     100   AAFSSASVSGGAGRCSSGG--FGSRSLYSLGGRKSISM---SVAGARQGA   144
NP_001091855.1      28   AAFSSASMSGGAGRCSSGG--FGSRSLYNLGGNKSISI---SMAGCRQGA   72
NP_032501.2         28   VAFSSGSMSGGAGRCSSGG--FGSRSLYNLGGHKSISM---SVAGSCQGG   72
NP_001008806.1      28   VAFSSASMSGGAGRCSSGG--FGSRSLYNLGGHKSISM---SVAGSCQGG   72
XP_001231586.2      25   VTFSTVARGCRGPAGNAGG--FSSHSLYSLGGCKSTALGGFGAGGICRGF   72
XP_002935776.1      20   FSSFSVSKSGGGFGGSSGGGSFGSRSLYSVGSRKVSSV------GSASGG   63


NP_002263.3         73   CFG-GAG---------------GFGTGGF--------------------G   86
XP_003313727.2      73   CFG-GAGGFGTGGFG-AGGFGAGFGTGGF--------------------G   100
XP_002798645.1      73   CFG-GAG---------------GFGTGGF--------------------G   86
XP_003433546.1     145   GFG-AAA-----GFG-AGSFGAGFGAGNF--------------------G   167
NP_001091855.1      73   GFG-AAG-----GFGAAGGFGSGFGAGGF--------------------G   96
NP_032501.2         73   GYG-GAG-----GFG-VGGYGAGFGAGGF--------------------G   95
NP_001008806.1      73   GYG-GAG-----GFG-VGGYGAGFGAGGF--------------------G   95
XP_001231586.2      73   GAG-GQG------FGYGVGNGIGFG-GGA--------------------G   94
XP_002935776.1      64   GFGFAAG-----GFG-GRGFGGGVGGGAFGGAGGGAFGGAGGGAFGGAGG   107


NP_002263.3         87   GGFGG-SFSGKGG------PGFPVCPAGGIQEVTINQSLLTPLHVEIDPE   129
XP_003313727.2     101   GGFGG-SFSGKGG------PGFPVCPAGGIQEVTINQSLLTPLHVEIDPE   143
XP_002798645.1      87   GGFGG-SFSGKGG------PGFPVCPAGGIQEVTINQSLLTPLHVEIDPE   129
XP_003433546.1     168   SGFGG-SFSGRGG------PGFPVCPAGGIQEVTINQSLLTPLHVEIDPE   210
NP_001091855.1      97   SGFGG-SFGGRGG------AGFPVCPAGGIQEVTINQSLLTPLHVEIDPE   139
NP_032501.2         96   GGFGG-SFNGRGG------PGFPVCPAGGIQEVTINQSLLTPLQVEIDPE   138
NP_001008806.1      96   GGFGG-SFNGRGG------PGFPVCPAGGIQEVTINQSLLTPLQVEIDPE   138
XP_001231586.2      95   CGFGG-GFGGFGGGFDGGVGGFAQCPPGGIKEVTINQSLLTPLHLEIDPE   143
XP_002935776.1     108   GGFGGAGFGGFGG------AGFPGGPSVGIQEVTVNQSLLAPLNLEIDPT   151


NP_002263.3        130   IQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQ---QT   176
XP_003313727.2     144   IQKVRTEEREQIKLLNNKFASFIDKVRFLEQQNKVLETKWNLLQQ---QT   190
XP_002798645.1     130   IQKVRTEEREQIKLLNNKFASFIDKVRFLEQQNKVLETKWKLLQQ---QT   176
XP_003433546.1     211   IQKVRTEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWSLLQQ---QT   257
NP_001091855.1     140   IQKVRTEEREQIKLLNNKFASFIDKVRFLEQQNKVLETKWKLLQQ---QT   186
NP_032501.2        139   IQKIRTAEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQ---QT   185
NP_001008806.1     139   IQKIRTAEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQ---QT   185
XP_001231586.2     144   IQKVRTQEREELKTLNNKFASFIDKVRFLEQQNKVLETKWKLLQE---QS   190
XP_002935776.1     152   IQKVRLEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWSLLQEQGGQV   201


NP_002263.3        177   TTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTK   226
XP_003313727.2     191   TTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTK   240
XP_002798645.1     177   TSTSSKNLEPLFETYLSVLRKQLDTLVNDKGRLQSELKTMQDSVEDFKTK   226
XP_003433546.1     258   TTTSSKNLEPLFEAYISALRKQLDTLVNDKGRLQSELKTTQDSVEDFKTK   307
NP_001091855.1     187   TTTSVKNLEPFFEAYINALRKQVDSLANDKGRLQSELKIMQDSVEDYKTK   236
NP_032501.2        186   TTTSPKSLDPFFETYINALRKNLDTLSNDKGRLQSELKMMQDSVEDFKTK   235
NP_001008806.1     186   TTTSPRNLDPFFETYINALRKNLDTLSNDKGRLQSELKLMQDSVEDFKTK   235
XP_001231586.2     191   PTTSTRSLDPYFEAYISRLRKQLDGLSSEKIQLESELKSFQDMVEDFKTK   240
XP_002935776.1     202   KGSRKNNIDPIFDAYINSLKRQLDALQNDKLRLDGELRNMQDLVDDFKNK   251


NP_002263.3        227   YEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLY   276
XP_003313727.2     241   YEEEINKRTAAENDFVVLKKDVDAAYMNKVELEAKVDSLNDEINFLKVLY   290
XP_002798645.1     227   YEEEINKRTAAENDFVVLKKDVDAAYMNKVELEAKVDSLNDEINFLKVLY   276
XP_003433546.1     308   YEDEINKRAAAENDFVVLKKDVDAAYMNKVELEAKVDALNDEINFLRVLF   357
NP_001091855.1     237   YEDEINKRAAAENDFVVLKKDVDAAYMNKVELEAKVDALNDEINFLRVLY   286
NP_032501.2        236   YEEEINKRTAAENDFVVLKKDVDAAYMIKVELEAKMESLKDEINFTRVLY   285
NP_001008806.1     236   YEEEINKRTAAENDFVVLKKDVDAAYMIKVELEAKMESLKDEINFMRVLY   285
XP_001231586.2     241   YEEEINKRTAAENDFVLLKKDVDGVYMNKVELQAKLDSLADELNFLRNLY   290
XP_002935776.1     252   YEDEINKRTSAENEFVVIKKDVDAAYMGKVELEAKVDALTDELNFLRTFF   301


NP_002263.3        277   DAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEA   326
XP_003313727.2     291   DAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEA   340
XP_002798645.1     277   DAELSQMQTHVSDMSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEA   326
XP_003433546.1     358   AAELSQMQTHVSDTSVVLSMDNNRDLDLDSIIAEVRAQYEEIAQKSKAEA   407
NP_001091855.1     287   AAELSQMQTQVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEA   336
NP_032501.2        286   EAELAQMQTHVSDTSVVLSMDNNRNLDLDGIIAEVRAQYEDIARKSKAEV   335
NP_001008806.1     286   EAELSQMQTHVSDTSVVLSMDNNRNLDLDGIIAEVRAQYEEIARKSKAEV   335
XP_001231586.2     291   ETELCQMQKTVSDTSVVLSMDNNRCLDLDSIIAEVKAQYEEIANRSRLEA   340
XP_002935776.1     302   EAELGELQAQISDTSVVLSMDNNRALDLESIIAEVKSQYEDIAKKSRAEA   351


NP_002263.3        327   EALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQC   376
XP_003313727.2     341   EALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQC   390
XP_002798645.1     327   EALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQV   376
XP_003433546.1     408   EALYQTKVQQLQISVDQYGDNLKNTKNEISELNRMIQRLRAEIENVKKQC   457
NP_001091855.1     337   EALYQIKVQQLQTSVDQHGDSLRNTKNEISELNRLIQRLRAEIENVKKQC   386
NP_032501.2        336   ESWYQIKVQQLQMSADQHGDSLKTTKNEISELNRMIQRLRAEIENIKKQS   385
NP_001008806.1     336   ESWYQIKVQQLQMSADQHGDSLKSTKNEISELNRMIQRIRSEIENIKK--   383
XP_001231586.2     341   EAWYQSKYKELQATAGKHGDSLRDTKAEISELNRVIQRLRAEIENVKKQC   390
XP_002935776.1     352   ESVYQGKVQELQASAGEQGDVLRNTKSEISELNRKSQRLKAEIENVKKQI   401


NP_002263.3        377   QTLQVSVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLREYQELM   426
XP_003313727.2     391   QTLQASVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLREYQELM   440
XP_002798645.1     377   GTLQASVADAEQRGENALKDAHSKRIELETALQQAKEELARMLREYQELM   426
XP_003433546.1     458   QTLQASVADAEQRGELALKDAQSKYKELEAALHQAKEELARMLREYQELL   507
NP_001091855.1     387   QTLQGSVADAEQRGEVALKDAYSKRTELEAALQKAKEELARVLREYQELM   436
NP_032501.2        386   QTLQASVADAEQRGELALKDAYSKRAELETALQKAKEDLARLLRDYQALM   435
NP_001008806.1     384   QTLQASVADAEQRGELALKDAYTKRADLETALQKAKEDLARLMRDYQELM   433
XP_001231586.2     391   ESVQSSIADAEQRGELALKDARDKLTELETALKKAKADLAQQLRDYQELM   440
XP_002935776.1     402   AKLQASITEAEERGDLVLKDAQSKLAELEAALQKVKQDMARQLREYQELM   451


NP_002263.3        427   SVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVV--SGSTSTGGISG   474
XP_003313727.2     441   SVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVV--SGSTSTGGISR   488
XP_002798645.1     427   SVKLALDIEIATYRKLLEGEECRMSGECQSAVSISVV--GGSTSTGGISG   474
XP_003433546.1     508   SVKLALDVEIATYRKLLEGEESRMSGECQSAMSISVV--GGIASAGGISG   555
NP_001091855.1     437   SVKLALDIEIATYRKLLEGEECRMSGECQSAVSISVV--GGAASAGGLGG   484
NP_032501.2        436   NVKLALDVEIATYRKLLEGEECRMSGECKSAVSISVV--GGSASIGGS--   481
NP_001008806.1     434   NVKLALDVEIATYRKLLEGEECRMSGECKSAVSISVV--GGSASIGGSGG   481
XP_001231586.2     441   NVKLALDIEIATYRKLLEGEECRMSGECQSNVSISVV--GGSSSIGGGYG   488
XP_002935776.1     452   NVKLALDVEIATYRKLLEGEEFRLNSDV-NNVSISVISSGGKSSLGGGGG   500


NP_002263.3        475   -GLGSGSGFGLSS-----------------GFGSGSGSGFGF-----GGS   501
XP_003313727.2     489   -GLGSGSGFGLSS-----------------GFGSGSGSGFGF-----GGS   515
XP_002798645.1     475   -GLGSGSGFGLSS-----------------GFGSGSGSGFGF-----GGS   501
XP_003433546.1     556   -GLGSCSGFGLGS-----------------GFGSGSGSGFGF-----GGG   582
NP_001091855.1     485   -ALGGSSGFGLGSGSCAVGLGGGLGGSSGFGLGSGSGSGFGF-----GGG   528
NP_032501.2        482   -GLGLGSGF---------------------CSGSGSGSGFGF-----GGG   504
NP_001008806.1     482   IGLGLGSGF---------------------GSGSCSGSGFGF-----GGG   505
XP_001231586.2     489   GGLCLGGGLGFGSGS---------------GRGSCSTGGAGFCYSLGGGG   523
XP_002935776.1     501   ---GSGAGFGFGSGGAAFGGSGGAAFG---GSGGAAFGGSGVSFGSGGGG   544


NP_002263.3        502   VSGSSSSKII-------STTTLNKR--R----------   520
XP_003313727.2     516   VSGSSSSKII-------STTTLNKR--R----------   534
XP_002798645.1     502   VSGSSSSKII-------STTTLNKR--R----------   520
XP_003433546.1     583   VCGSSGSKIV-------STTTLTKRSHR----------   603
NP_001091855.1     529   IGGSSSGKII-------STTTVSKKSFR----------   549
NP_032501.2        505   IYGGSGSKIT-------SSATITKRSPR----------   525
NP_001008806.1     506   IYGSSGTKIT-------SSATITKRSPRTRQDPDGLQP   536
XP_001231586.2     524   FSSGTGSSVVVGSGGVLKNSSVSARRP-----------   550
XP_002935776.1     545   FSSSSSSFGGGVGSVRYSSSQSSYRS------------   570


Protein Acc. Gene Organism
NP_002263.3 KRT4 H.sapiens
XP_003313727.2 KRT4 P.troglodytes
XP_002798645.1 KRT4 M.mulatta
XP_003433546.1 KRT4 C.lupus
NP_001091855.1 KRT4 B.taurus
NP_032501.2 Krt4 M.musculus
NP_001008806.1 Krt4 R.norvegicus
XP_001231586.2 KRT4 G.gallus
XP_002935776.1 LOC100489468 X.tropicalis


Support Center