Display Settings:

Format

Send to:

Choose Destination
HomoloGene:1880. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001005340.1       1   -----------------------------------MECL-YYFLGFLLLA   14
XP_001157101.2       1   -----------------------------------MECL-YYFLGFLLLA   14
XP_001099643.2       1   MILPEALYLIKIEREAPQMPEEHCCFWWMGPEEFSMECL-YYFLGFLLLA   49
XP_539472.2          1   -----------------------------------MECL-YCFLGCLLLA   14
NP_001033154.1       1   -----------------------------------MECL-YCFLGFLLLA   14
NP_444340.3          1   -----------------------------------MESL-CGVLGFLLLA   14
NP_579832.1          1   -----------------------------------MESL-CGVLVFLLLA   14
XP_425991.2          1   ------------------------------------MCGAHRHLVLLLLA   14
XP_691804.2          1   -------------------------------------MMRLELLFVLAWA   13
NP_001124514.1       1   -----------------------------------MKCLVSAALVLLLLL   15


NP_001005340.1      15   ARLP-LDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWK   63
XP_001157101.2      15   ARLP-LDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWK   63
XP_001099643.2      50   ARLP-LDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWK   98
XP_539472.2         15   ARLP-LDAAIKFHDVLSNERISGYLREHNQLTGWSSDENDWNEELYPVWK   63
NP_001033154.1      15   AGLP-LDAAKRFHDVLSNERPSGYMREHNQLSGWSSDENDWNEKLYPVWK   63
NP_444340.3         15   AGLP-LQAAKRFRDVLGHEQYPDHMREHNQLRGWSSDENEWDEHLYPVWR   63
NP_579832.1         15   AGLP-LQAAKRFRDVLGHEQYPDHMRENNQLRGWSSDENEWDEQLYPVWR   63
XP_425991.2         15   EAVL-CAAAMRFQDVLSNGRTAPV-TYHKKIQGWSSDQNKWNDKLYPFWE   62
XP_691804.2         14   FFVPGTNSKKTYGDMFPHKHKLPF---PFPIPGWEPDTNPWDESLYPPFK   60
NP_001124514.1      16   QFSG-TQAVKRFNDVMVLGRQPSYGNSHKRLHGWSPGSKYWDEKLYPSWK   64


NP_001005340.1      64   RGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGN   113
XP_001157101.2      64   RGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGN   113
XP_001099643.2      99   RGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFVVNLVFPRCQKEDANGN   148
XP_539472.2         64   KGDSRWKNSWKGGHVRAILTSDSPALVGSTITFVVDLVFPRCQREDVSGN   113
NP_001033154.1      64   RGDSRWKSSWKGGRVQAVLTSDSPALVGSTITFAVNLVFPRCQKEDASGN   113
NP_444340.3         64   RGDGRWKDSWEGGRVQAVLTSDSPALVGSNITFVVNLVFPRCQKEDANGN   113
NP_579832.1         64   RGEGRWKDSWEGGRVQAALTSDSPALVGSNITFVVNLVFPRCQKEDANGN   113
XP_425991.2         63   DNDPRWKDCWKGGKVTTKLVTDSPALVGSNVTFVVTLQFPKCQKEDYDGN   112
XP_691804.2         61   PQLTRRHEK----PPKVRLTSDSPAMNGSCISFTAALEFPPCQKEDSNGN   106
NP_001124514.1      65   AGDARWEKCWKGGKVVARLTSDSPALIGSNITFAVILQFPRCQKEDANGD   114


NP_001005340.1     114   IVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFP   163
XP_001157101.2     114   IVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFP   163
XP_001099643.2     149   IVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFP   198
XP_539472.2        114   IVYEKNCGNDTGPSPDLYVYNWT---EEGSWGNGTNEHHHDVFPDGKPFP   160
NP_001033154.1     114   IVYEKNCRNDTGASPDLYVYNWTAGTEDSDWGNDTSEGHHNVFPDGKPFP   163
NP_444340.3        114   IVYEKNCRNDLGLTSDLHVYNWTAGADDGDWEDGTSRSQHLRFPDRRPFP   163
NP_579832.1        114   IVYERNCRSDLELASDPYVYNWTTGADDEDWEDNTSQGQHLRFPDGKPFP   163
XP_425991.2        113   IMYQRNCTPDSPAAQDQYVYNWTEWIDNCGWENCTSNHSHNVFPDGRPFP   162
XP_691804.2        107   LVYDEHCDDANGQLRSGYVFNWTSWLDDYGYGKCTDLKRCNVFPDGKPFP   156
NP_001124514.1     115   IVYESQCLNGSASLQDQYVYNWTKWNDFCNEGNCSFN---NKFPDGSPFP   161


NP_001005340.1     164   HHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVY   213
XP_001157101.2     164   YHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVY   213
XP_001099643.2     199   HHPGWRRWNFVYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVY   248
XP_539472.2        161   HHPGWKRCNFVYVFRTLGQYLQKLGRGSARVSVNTANVTLGPHLMEVIVY   210
NP_001033154.1     164   RP--WKK-NFVYVFHTLGQYFQKLGQCSVTISINTANVSLGPQIMEVTVY   210
NP_444340.3        164   RPHGWKKWSFVYVFHTLGQYFQKLGRCSARVSINTVNLTAGPQVMEVTVF   213
NP_579832.1        164   RPHGRKKWNFVYVFHTLGQYFQKLGQCSARVSINTVNLTVGPQVMEVIVF   213
XP_425991.2        163   HYPGWRRRNFVYLFHTFGQYYQTIGQSSAIFSINTANITLGKHRMAVSIY   212
XP_691804.2        157   QTNDWRRRGYVYVWHTMGQYFETCDGSSSHLTLNTTNMTFGADVMEVMVY   206
NP_001124514.1     162   YHRDWRRRNFIYIFQTLGQYYQQSGGSSALLSLNTTNITAGTQMLEVSVY   211


NP_001005340.1     214   R-RHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDE-TFLKDLPI   261
XP_001157101.2     214   R-RHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDE-TFLKDLPI   261
XP_001099643.2     249   R-RHGRAYVPIAQVKDVYVVTDQIPVFVTMSQKNDRNSSDE-TFLKDLPI   296
XP_539472.2        211   R-RHRHAYVPIAKVKDVYVVTDHIPVFVTMYQKNDRNLSDE-TFLRDLPI   258
NP_001033154.1     211   R-RHRRAYVPIAKVKDVYVVTDQIPVFVTMSQKNNRNSSDE-TFLRDLPI   258
NP_444340.3        214   R-RYGRAYIPISKVKDVYVITDQIPVFVTMSQKNDRNLSDE-IFLRDLPI   261
NP_579832.1        214   R-RHGRAYIPISKVKDVYVITDQIPIFVTMYQKNDRNSSDE-TFLRDLPI   261
XP_425991.2        213   R-RGHSTYVPIARASTTYVVTDKIPIFVSMTQKHDRNISDS-IFIKDSPI   260
XP_691804.2        207   RKRERRKYSPLSTDKSVYFITDKIPLSVNISQKEAASRADRNIFVRGSDV   256
NP_001124514.1     212   R-RGHKQHYPVTKASLIYVVTDEIPFYVNISQKNDRNASDR-IFIKDSPI   259


NP_001005340.1     262   MFDVLIHDPSHFLNYS-TINYKWSFGDNTGLFVSTNHTVNHTYVLNGTFS   310
XP_001157101.2     262   MFDVLIHDPSHFLNYS-TINYKWSFGDNTGLFVSTNHTVNHTYVLNGTFS   310
XP_001099643.2     297   TFDVLIHDPSHFLNYS-TINYKWSFGDNTGLFVSINHTVNHTYVLNGTFS   345
XP_539472.2        259   MFNVLIHDPSHFLNES-AIYYKWNFGDNTGLFVSNAPTLNHTYVLNGTFS   307
NP_001033154.1     259   TFSVLIHDPSHFLNES-AIYYKWNFGDNTGLFVSNNHTLNHTYVLNGTFS   307
NP_444340.3        262   VFDVLIHDPSHFLNDS-AISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFN   310
NP_579832.1        262   FFDVLIHDPSHFLNYS-AISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFN   310
XP_425991.2        261   TFDVKIHDPSHYFNDS-AISYKWNFGDGSGLFVESGATTSHTFALQGNFT   309
XP_691804.2        257   IFNVQLHDPSNYLKTADAVDFIWDFRDGNQL-VTHSSVATHAYDMLGNVT   305
NP_001124514.1     260   NFDIKIHDPSHYLNNS-AVSFAWNFGDGSGSFVSNNPVSTHTYTLLGNFS   308


NP_001005340.1     311   LNLTVKAAAPGPC-PPPPPPPR-----------PSKPT------------   336
XP_001157101.2     311   LNLTVKAAAPGPC-PPPPPPPR-----------PSKPT------------   336
XP_001099643.2     346   LNLTVKAAAPGPCPPPPPPPPR-----------PPKPT------------   372
XP_539472.2        308   LNLTVQASVPGPC---PSPSPT-----------PPKPT------------   331
NP_001033154.1     308   LNLTVQAEVPGPC---PLPSPR-----------PPKTT------------   331
NP_444340.3        311   LNLTVQTAVPGPC---PPPSPSTPPPPSTPPSPPPSPL------------   345
NP_579832.1        311   FNLTVQTAVPGPC---PSPTPS--PSSSTSPSPASSPS------------   343
XP_425991.2        310   LNLTVQAIIPVPC---KPVTPT-----------SSLPT------------   333
XP_691804.2        306   VKLLVEAAFRVPC---PPPTPT--PVHFTQAHTTAIPT-----LPPGTHT   345
NP_001124514.1     309   LNLTIKAAIPGPC---KPLTTT-----------PALPTTALPMPTTTVFP   344


NP_001005340.1     337   ----------PSLATTLKSYDSNTPGPAGDNPLELSR-------IPDEN-   368
XP_001157101.2     337   ----------PSLATTLNSYDSNTPGPAGDNPLELSR-------IPDEN-   368
XP_001099643.2     373   ----------PSLATTLKSCYSNTPGPAGDNPLGLSE-------IPDEN-   404
XP_539472.2        332   -----------SLSS------------AGDNPLELRK-------TSGIT-   350
NP_001033154.1     332   ----------PPLVT------------AGDSTLELRE-------IPDES-   351
NP_444340.3        346   ----------PTLST-----PSPSLMPTGYKSMELSD-------ISNEN-   372
NP_579832.1        344   ----------PTLST-----PSPSLMPTGYKSMELSD-------ISNEN-   370
XP_425991.2        334   ----------PAVTT----EVSSNSDPSAPNEITEDN--------PDGG-   360
XP_691804.2        346   FTSKMETTKAPVISSALPMTTTRVPTTAIPTTEPFQTDSEVTATAPESSS   395
NP_001124514.1     345   RNTTGNATDDPALFT----TEPAPTEPAPTTTTTLRNTTTAVPTTAAAG-   389


NP_001005340.1     369   --------------------CQINRYGHFQATITIVEGILEVNIIQMTDV   398
XP_001157101.2     369   --------------------CQINRYGHFQATITIVEGILEVNIIQMTDV   398
XP_001099643.2     405   --------------------CQINRYGHFQATITIVEGILEVNIIQTTDV   434
XP_539472.2        351   --------------------CLINRYGYFKATITIVEGILEVNIIQMTDV   380
NP_001033154.1     352   --------------------CHITRYGYFKATITIVEGILEVNIIQVTDV   381
NP_444340.3        373   --------------------CRINRYGYFRATITIVEGILEVSIMQIADV   402
NP_579832.1        371   --------------------CRINRYGYFRATITIVDGILEVNIIQVADV   400
XP_425991.2        361   --------------------CHIYRYGYYAAGITIVEGILEVNIIQMTSI   390
XP_691804.2        396   SYNQPTAPPLLKHKHFQESDCFRHMYGSFEGEIILIERPPALQNLPANQI   445
NP_001124514.1     390   --------------------CFIYRYGHYRTNITVVDGIVEVNIIEMTNV   419


NP_001005340.1     399   L-MPVPWPESSLIDFVVTCQGSIPTEVCTIISDPTCEITQNTVCSPV--D   445
XP_001157101.2     399   L-MPVPWPDSSLIDFVVTCQGSIPTEVCTIISDPTCEITQNTVCSPV--D   445
XP_001099643.2     435   L-MLVPGPDSSLIDFVVTCQGSIPTEVCTIISDPTCEITQNAVCSPV--D   481
XP_539472.2        381   L-MPVPQPDNSLMDFVVTCQGMMPTEVCTVVSDPTCQITYDTVCDPVGED   429
NP_001033154.1     382   P-MPRPQPDNSLVDFVVTCHGSIPTEVCTIISDPSCQITQNPVCDPVAME   430
NP_444340.3        403   P-MPTPQPANSLMDFTVTCKGATPMEACTIISDPTCQIAQNRVCSPV--A   449
NP_579832.1        401   P-IPTLQPDNSLMDFIVTCKGATPTEACTIISDPTCQIAQNRVCSPV--A   447
XP_425991.2        391   Q-MTESQAENPLVDFVVTCQGSLPTDVCTAVSDPTCQVSQGMICDPV--I   437
XP_691804.2        446   LKVSADKVSNTSVNFMVTCSGSVPSVACTIVANSACREVKNIVCEDVT-P   494
NP_001124514.1     420   Q-VPASQTENALIDFVVTCQGSLPTDVCTLISDSTCMIPQNMVCEEV--P   466


NP_001005340.1     446   VDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTS----TLISVPDRDPA   491
XP_001157101.2     446   VDDMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTS----TLISVPDRDPA   491
XP_001099643.2     482   VDEMCLLTVRRAFNGSGTYCVNLTLGDDTSLALTS----TLISVPDRDPA   527
XP_539472.2        430   MGHECLLTVRRAFSGSGTYCMNLTLGDNTSLALTS----TLVSIPARDPA   475
NP_001033154.1     431   LGDTCLLTVRRAFSGSGTYCMNLTLGNDASLALTS----TLVSINSRDPA   476
NP_444340.3        450   VDGLCLLSVRRAFNGSGTYCVNFTLGDDASLALTS----TLISIPGKDPD   495
NP_579832.1        448   VDELCLLSVRRAFNGSGTYCVNFTLGDDASLALTS----ALISIPGKDLG   493
XP_425991.2        438   VTEECLITIRRAFDEPGTYCINITLGDDTSQALAS----ALISVNGG--S   481
XP_691804.2        495   YDEGCKISLTRIFQTPGTYCINITLGVPGGLALATTTSITIGNSPDKNSP   544
NP_001124514.1     467   AAEQCSLTLRRAFADPGTYCVNITLSDDASLALAS----TLVSVSGG--A   510


NP_001005340.1     492   SPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGL   541
XP_001157101.2     492   SPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGL   541
XP_001099643.2     528   SSLRMANTALISVGCLAIFVTVISLLVYKKHKKYKPIENSPANVVGSKGL   577
XP_539472.2        476   SPSRMANGVLVAVGCLAIFVTVITLWVYKKHKEYNLIENSTGIVVKGKGL   525
NP_001033154.1     477   SLLRTANGILVSLGCLAILVTVIAFLMYKKHKEYKPIENSPGIVIRGKGL   526
NP_444340.3        496   SPLRAVNGVLISIGCLAVLVTMVTILLYKKHKAYKPIGNCPRNTVKGKGL   545
NP_579832.1        494   SPLRTVNGVLISIGCLAMFVTMVTILLYKKHKTYKPIGNCTRNVVKGKGL   543
XP_425991.2        482   S-SGTTKGIFIFLGLLAVFGAIGAFVLYKRYKQYKPIERSAGQAENQEGL   530
XP_691804.2        545   KSPHVAEVVLSSSAVLICIFAFIAYMVYKRYKVYRPVRRSMLEDAERNTD   594
NP_001124514.1     511   AKQKTVAAVLVPLGLVVIALAVVGAILLKKYKEYRPIDNAA--TSDTRGL   558


NP_001005340.1     542   SVFLNRAKAVFFPGNQEKDPLLKNQEFKGVS   572
XP_001157101.2     542   SVFLNRAKAVFFPGNQEKDPLLKNQEFKGVS   572
XP_001099643.2     578   SAFLNRAKAVFFPGNQEKDPLLKNQEFKGVS   608
XP_539472.2        526   NVFLNRAKAMFYPGIQEKDPLLKHQ--PGTP   554
NP_001033154.1     527   NVFLNHAKTLFFPGNQEKDPLLKNQ--PGIL   555
NP_444340.3        546   SVLLSHAKAPFFRGDQEKDPLLQDK--PRTL   574
NP_579832.1        544   SVFLSHAKAPFSRGDREKDPLLQDK--PWML   572
XP_425991.2        531   SAYISNFKAFFFPKSTERNPLLKSK--PGIV   559
XP_691804.2        595   SWGLGKLRAVLFSVDEERSCLLTEK--PQ--   621
NP_001124514.1     559   SVYFSQVKSAFFPGNNEQDPLLKSK--QGII   587


Protein Acc. Gene Organism
NP_001005340.1 GPNMB H.sapiens
XP_001157101.2 GPNMB P.troglodytes
XP_001099643.2 GPNMB M.mulatta
XP_539472.2 GPNMB C.lupus
NP_001033154.1 GPNMB B.taurus
NP_444340.3 Gpnmb M.musculus
NP_579832.1 Gpnmb R.norvegicus
XP_425991.2 GPNMB G.gallus
XP_691804.2 gpnmb D.rerio
NP_001124514.1 gpnmb X.tropicalis


Support Center