Display Settings:

Format

Send to:

Choose Destination
HomoloGene:172. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000197.1          1   -----MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDT------TAD   39
XP_003954068.1       1   -----MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDT------TAD   39
NP_001030606.1       1   -----MLKPSLPFRSLLVLQLPLLGVALNTTILTPNGNEDA------TTD   39
NP_001003201.1       1   -----MLKPPLPLRSLLFLQLSLLGVGLNSTVPMPNGNEDI------TPD   39
NP_776784.1          1   -----MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIGGKPGTGGD   45
NP_038591.1          1   -----MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDI------KAD   39
NP_543165.1          1   -----MLKPLLPSRSFLLLQLLLLRVGWSSKVLMSSGNEDT------KSD   39
NP_989858.1          1   --------MAVPGASLVPILLLGLGTCLAAS-------------------   23
NP_001121743.1       1   -------------MKLLFLTLFFGNFCTFSA-------------------   18
NP_001116522.1       1   --------MTYIHTSRLYFRLLFLILCFQQC-------------------   23
XP_002934932.1       1   MSGIFYGNMRKMGSSLFIITFLLLNCCSQAN-------------------   31


NP_000197.1         40   FFLTTMPTDSLSVSTLPLPE-VQCFVFNVEYMNCTWNSSSEPQPTNLTLH   88
XP_003954068.1      40   FFLTSMPTDSLSVSTLPLPE-VQCFVFNVEYMNCTWNSSSEPQPTNLTLH   88
NP_001030606.1      40   FFLTSMPTDSLSVSTLPLPE-VQCFVFNVEYMNCTWNSSSEPQPTNLTLH   88
NP_001003201.1      40   FFLTATPSETLSVSSLPLPE-VQCFVFNVEYMNCTWNSSSEPRPTNLTLH   88
NP_776784.1         46   FFLTSTPAGTLDVSTLPLPK-VQCFVFNVEYMNCTWNSSSEPQPNNLTLH   94
NP_038591.1         40   LILTSTAPEHLSAPTLPLPE-VQCFVFNIEYMNCTWNSSSEPQATNLTLH   88
NP_543165.1         40   LLLTSMDLKHLSVPTLPLPE-VQCFVFNVEYMNCTWNSSSEPQPTNLTMH   88
NP_989858.1         24   ----------------PSPKGVECILFNEEYMTCTWG-SGQTLTANYSLY   56
NP_001121743.1      19   ----------------SSDPKINCLIINLDYVNCTW--SEH--QYNYSLK   48
NP_001116522.1      24   ----------------S----VQCKIINVDYVECIW--QRNLSTMNYTFS   51
XP_002934932.1      32   ----------------SIT--VNCIVTQEKSMTCMWN-KEALSPENYSLY   62


NP_000197.1         89   YWYKNSD-NDKVQKCSHYLFSEEITSGCQLQ-KKEIHLYQTFVVQLQDP-   135
XP_003954068.1      89   YWYKNSD-NDKVQKCSHYLFSEEITSGCQLQ-KKEIHLYQTFVVQLQDP-   135
NP_001030606.1      89   YWYKNSD-NDKVQKCSHYLFSEEITSGCQLQ-EKEIHLYQTFVVQLQDP-   135
NP_001003201.1      89   YWYKNSN-DDKVQECGHYLFSREVTAGCWLQ-KEEIHLYETFVVQLRDP-   135
NP_776784.1         95   YGYRNFNGDDKLQECGHYLFSEGITSGCWFG-KKEIRLYETFVVQLQDP-   142
NP_038591.1         89   YRYKVSD-NNTFQECSHYLFSKEITSGCQIQ-KEDIQLYQTFVVQLQDP-   135
NP_543165.1         89   YRYKGSD-NNTFQECSHYLFSKEITSGCQIQ-KEDIQLYQTFVVQLQDP-   135
NP_989858.1         57   YWY--EN-KLPVVECQQYLWDRSVRIGCRFE-QSEIIQFQAFYVRVNASC   102
NP_001121743.1      49   GGFSYFD---IE-DCPEYETANGVNVACMLPYKERTQRFNTLKTSLYR--   92
NP_001116522.1      52   SMFANDG---LDRGCPKYILEQNYT-GCRIPLKDQNLRFNKFIVTIYT--   95
XP_002934932.1      63   YWYTSDG-NTTAAPCTRYLQENGINIGCWFN-SSAVRTFKEFNVRLNSSS   110


NP_000197.1        136   -REPRRQATQMLKLQNLVIPWAPENLTLH-KLSESQLELNWNNRFL---N   180
XP_003954068.1     136   -REPRRQATQMLKLQNLVIPWAPENLTLH-KLSESQLELNWNNRFL---N   180
NP_001030606.1     136   -REPRRQATQMLKLQNLVIPWAPENLTLR-KLSESQLELNWNNRFL---N   180
NP_001003201.1     136   -REPRRQSTQKLKLQNLVIPWAPENLTLH-NLSESQLELSWSNRHL---D   180
NP_776784.1        143   -REHRKQPKQMLKLQDLVIPWAPENLTLR-NLSEFQLELSWSNRYL---D   187
NP_038591.1        136   -QKPQRRAVQKLNLQNLVIPRAPENLTLS-NLSESQLELRWKSRHI--KE   181
NP_543165.1        136   -QKPQRRAEQKLNLQNLVIPWAPENLTLY-NLSESQVELRWKSRYI---E   180
NP_989858.1        103   NGQTLEIPSNRMELQNLVKPEAPVNLTIH-NMSGNQLQLTWSSPYP--KE   149
NP_001121743.1      93   -DDGSLVTEQEHMLKEYVKLNPPTNLSVV-EKKDAELWLYWNVTK---ND   137
NP_001116522.1      96   -EGKHTISKTFDSLERNVLLNPPYNLSVMWNEHSDTLSLYWNSSAP-LRK   143
XP_002934932.1     111   KQEHVQRFRN---LQNLVRLEPPVKLHVE-NRSDLELLLSWEPLLGQFKD   156


NP_000197.1        181   HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPL   230
XP_003954068.1     181   HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPL   230
NP_001030606.1     181   HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPL   230
NP_001003201.1     181   HCLEHVVQYRSDWDRSWTEQSVDHRNSFSLPSVDGQKFYTFRVRSRYNPL   230
NP_776784.1        188   HCLEHLVQYRSDRDRSWTEQSVDHRHSFSLPSVDAQKLYTFRVRSRYNPL   237
NP_038591.1        182   RCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPI   231
NP_543165.1        181   RCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPI   230
NP_989858.1        150   QCLEHVVKYKSNKDTSWTNQEVKGV-IFSFPSVDYEKYYTFYVRSKINNY   198
NP_001121743.1     138   NCIESEVRYRTDQNN-WKDTTPGVRTTYSL-PFPSNKQYKFQVRARITSS   185
NP_001116522.1     144   TCIVYMVRNQKDPSQ-SLNVTD---TSYSVSPVSQNKLYVFQVRSTVADS   189
XP_002934932.1     157   HCLTYQVQYRSLASNSWTVKNVTIK-QFSLPSYSRDKLYTFHVRSKLNEL   205


NP_000197.1        231   CGS--AQHWSEWSHPIHWGSNTSKEN------P-----------------   255
XP_003954068.1     231   CGSAHAQHWSERSHPIHWGSNTSKEN------P-----------------   257
NP_001030606.1     231   CGS--AQHWSEWSHPIHWGSNSSKEN------P-----------------   255
NP_001003201.1     231   CGS--AQRWSEWSHPIHWGSNTSKEN------------------------   254
NP_776784.1        238   CGS--AQHWSDWSYPIHWGSNTSKENIENPENP-----------------   268
NP_038591.1        232   CGS--SQQWSKWSQPVHWGSHTVEEN------P-----------------   256
NP_543165.1        231   CGS--TQQWSKWSQPIHWGSHTAEEN------P-----------------   255
NP_989858.1        199   CGN--TQLWSEWSVPVFWGNNSTSKGSSGPERPRSPRRPRSVLTVSPRLV   246
NP_001121743.1     186   CGQ--SKFWSEWSESVTWGTEKAFNDTVFSPESLG---------------   218
NP_001116522.1     190   CGS--SDFWSDWSDPVEWS-------------GTG---------------   209
XP_002934932.1     206   CAS--TVLWSEWSVGVSWGRNDTT-----PSK------------------   230


NP_000197.1        256   --------FLFALEAVVISVGSMGLIISLLCVYFWLERT----MPRIP-T   292
XP_003954068.1     258   --------FLFALEAVVISVGSMGLIISLLCVYFWLERT----MPRIP-T   294
NP_001030606.1     256   --------FLFALEAVVISVGSMGLIISLLCVYFWLERT----MPRIP-T   292
NP_001003201.1     255   --------PLFASEAVLIPLGSMGLIISLICVYYWLERS----IPRIP-T   291
NP_776784.1        269   --------SLFALEAVLIPLGSMGLIVSLICVYCWLERT----MPRIP-T   305
NP_038591.1        257   --------SLFALEAVLIPVGTMGLIITLIFVYCWLER-----MPPIP-P   292
NP_543165.1        256   --------SLFALEAVLIPVGTMGLIITLIFVYCWLER-----MPRIP-A   291
NP_989858.1        247   AGVAEEQLQWFWIHTVLIPIASCLLLLVLVVLLVRMERVWVIIMPRIPNP   296
NP_001121743.1     219   --------SMSVTSLVLYAVGATILLVILSCLLVHSERLRIILIPVVPNA   260
NP_001116522.1     210   --------NSSRPGW-LYAILSVVLLSMLGFLLWYCERKKILSLPVVPDP   250
XP_002934932.1     231   ----ETSFPFKTIASVGFPI----VFFFLVVLFIRTERIWVILVPQIPNP   272


NP_000197.1        293   LKNLED----LVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEI---   335
XP_003954068.1     295   LKNLED----LVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEI---   337
NP_001030606.1     293   LKNLED----LVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEI---   335
NP_001003201.1     292   LKNLED----LVTEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEI---   334
NP_776784.1        306   LKNLED----LVTEYQGNFSAWSGVSKGLAESLQPDYSERLCHVSEI---   348
NP_038591.1        293   IKNLED----LVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEI---   335
NP_543165.1        292   IKNLED----LVTEYHGNFSAWSGVSKGLTESLQPDYSERFCHVSEI---   334
NP_989858.1        297   SKNFDD----LFITHNGDFQEWVGVPKDVVESFKPNYSESICHVSEL---   339
NP_001121743.1     261   GRNVSNYLAALFDNYDGNVEKWLSMPKDLENGFKPNFTERACPVREY---   307
NP_001116522.1     251   SINLQD----LFHKHDGNVESWIHISKELKEAFQPDYTEPSCDVCEVLPS   296
XP_002934932.1     273   EKNFQD----LYKIFNGDFQEWTGVSKDVVKSLNHTYTEPLCSVCE----   314


NP_000197.1        336   --------P---------PKGGALGEGPGASPCNQHSPYWAPPCYTLKPE   368
XP_003954068.1     338   --------S-----------------------------------------   338
NP_001030606.1     336   --------P---------PKGGALGEGPGPSPCNQHSPYWAPPCYTLKPE   368
NP_001003201.1     335   --------P---------PKGGAPGEGPGGSPCSQHSPYWAPPCYTLKPE   367
NP_776784.1        349   --------P---------PKG---GEGPGGSPCSQHSPYWAPPCYTLKPE   378
NP_038591.1        336   --------P---------PKGGALGEGPGGSPCSLHSPYWPPPCYSLKPE   368
NP_543165.1        335   --------P---------PKGGALGEGPGGSPCSLHSPYWPPPCYSLKPE   367
NP_989858.1        340   --------PSKEGYERLQDNGTHLPGVPGQQEHGPYKSSYVGA-------   374
NP_001121743.1     308   -------KIFSQSSSDSESILSNPTDVSSDYQSMHRYSSASTIPGSAEPL   350
NP_001116522.1     297   CDTISKPEACPESKASSDPEACPQTEICSQPETCSQLKACPEPEACPEPE   346
XP_002934932.1     315   ------------------DTECTVAEIKKPPPT-----------------   329


NP_000197.1        369   T--------------------------------------   369
XP_003954068.1           ---------------------------------------
NP_001030606.1     369   T--------------------------------------   369
NP_001003201.1     368   TGALIP---------------------------------   373
NP_776784.1        379   -----P---------------------------------   379
NP_038591.1        369   A--------------------------------------   369
NP_543165.1        368   A--------------------------------------   368
NP_989858.1              ---------------------------------------
NP_001121743.1     351   QTQNPSQVDNPV---------------------------   362
NP_001116522.1     347   ACPEPEACPEPEACPEAEICPAPQTDSSDKENTEEPQSS   385
XP_002934932.1           ---------------------------------------


Protein Acc. Gene Organism
NP_000197.1 IL2RG H.sapiens
XP_003954068.1 LOC101059843 P.troglodytes
NP_001030606.1 IL2RG M.mulatta
NP_001003201.1 IL2RG C.lupus
NP_776784.1 IL2RG B.taurus
NP_038591.1 Il2rg M.musculus
NP_543165.1 Il2rg R.norvegicus
NP_989858.1 IL2RG G.gallus
NP_001121743.1 il2rga D.rerio
NP_001116522.1 il2rgb D.rerio
XP_002934932.1 LOC100492995 X.tropicalis


Support Center